Align D-tagatose-1,6-bisphosphate aldolase subunit GatY; TBPA; TagBP aldolase; D-tagatose-bisphosphate aldolase class II; Tagatose-bisphosphate aldolase; EC 4.1.2.40 (characterized)
to candidate WP_092058754.1 BQ4888_RS16670 class II fructose-1,6-bisphosphate aldolase
Query= SwissProt::Q8VS16 (284 letters) >NCBI__GCF_900111775.1:WP_092058754.1 Length = 326 Score = 192 bits (487), Expect = 1e-53 Identities = 111/310 (35%), Positives = 173/310 (55%), Gaps = 43/310 (13%) Query: 3 IISSKNMLLKAQRLGYAVPAFNIHNLETMQVVVETAAELRSPLILAGTPGTYSYAGTG-- 60 +++++ + KA + GYA+PA+N +NLE +Q +V AE SP+I+ + G YA Sbjct: 12 LVNTRELFQKAVKGGYAIPAYNFNNLEQLQAIVLACAETSSPVIVQVSKGARDYANQTML 71 Query: 61 -----NVVAIARDLAKIWDLPLAVHLDHHEDLADITRKVQAGIRSVMIDGSHSPFEENVA 115 V +AR+L ++P+ +HLDH + V +G SVMIDGSH +EENVA Sbjct: 72 RYMALGAVQMARELGS--NIPICLHLDHGDSFELCKSCVDSGFSSVMIDGSHLAYEENVA 129 Query: 116 LVKSVVELSHRYDASVEAELGRLGGVEDDLGVDAKDALYTNPEQGREFVARTGIDSLAVV 175 L + VVE +H+YD SVE ELG L G+ED+ V A + YT PE+ +FV +TG+DSLA+ Sbjct: 130 LTRQVVEYAHKYDVSVEGELGVLAGIEDE--VQADHSTYTKPEEVEDFVKKTGVDSLAIS 187 Query: 176 IGTAHGLYAAE-------PKLGFAALPPISERV-DVPLVLHGASK--------------- 212 IGT+HG Y + P L F L + R+ P+VLHGAS Sbjct: 188 IGTSHGAYKFKLKDGEEVPPLRFDILEEVERRIPGFPIVLHGASSVVQEYVQLINQYGGK 247 Query: 213 ------LPDSDIRRAISLGVCKVNVATELKIAFSDALKHYFEENPDANEPRHYMKPAKAA 266 +P+ +R+A + VCK+N+ ++ ++A + ++ + +NP +PR Y+ AA Sbjct: 248 MDGAVGVPEGQLRKAAASAVCKINIDSDGRLAVTAKVREFLAKNPGEFDPRKYL---GAA 304 Query: 267 MKDVVRKVIH 276 K+++ + H Sbjct: 305 RKELITLIKH 314 Lambda K H 0.319 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 246 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 284 Length of database: 326 Length adjustment: 27 Effective length of query: 257 Effective length of database: 299 Effective search space: 76843 Effective search space used: 76843 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory