Align Fructose import ATP-binding protein FrcA; EC 7.5.2.- (characterized)
to candidate WP_092056230.1 BQ4888_RS08110 ABC transporter ATP-binding protein
Query= SwissProt::Q9F9B0 (260 letters) >NCBI__GCF_900111775.1:WP_092056230.1 Length = 230 Score = 88.6 bits (218), Expect = 1e-22 Identities = 68/233 (29%), Positives = 120/233 (51%), Gaps = 20/233 (8%) Query: 3 QEPILTARGLVKRYGRVTALDRA----DFDLYPGEILAVIGDNGAGKSSMIKAISGAVTP 58 + P++T +GL K Y + RA D L GE++ + G +G+GK++++ + + P Sbjct: 2 EHPVVT-QGLGKTYQEGKTVVRAVVDVDLQLKAGEVVGLFGPSGSGKTTLLSMLGCILKP 60 Query: 59 DEGEIRLEGKPI---QFRSPMEARQAGIETVYQNLALSPALSIADNMFLGREIRKPGIMG 115 G +L G I + + R+ I ++Q L PAL++ +N+ L +I+ G+ G Sbjct: 61 TAGSFKLFGHEIFGLREKDLPPLRKRYISYIFQGFNLFPALTVYENIMLVLKIK--GLTG 118 Query: 116 KWFRSLDRAAMEKQARAKLSELGLMTIQNINQAVETLSGGQRQGVAVARAAAFGSKVVIM 175 + A E AR ++E+GL + + LSGGQ+Q VAVARA A S +++ Sbjct: 119 R--------AAEDLARGMIAEVGLN--ERADFLPRDLSGGQKQRVAVARALAVESPLILA 168 Query: 176 DEPTAALGVKESRRVLELILDVRRRGLPIVLISHNMPHVFEVADRIHIHRLGR 228 DEPTA L ++V+E++ + V+++ + + ++ DRI GR Sbjct: 169 DEPTANLDHVNGKKVMEILRALAVEQKKCVVVATHDNRIEDIFDRILTMEDGR 221 Lambda K H 0.321 0.136 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 131 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 230 Length adjustment: 24 Effective length of query: 236 Effective length of database: 206 Effective search space: 48616 Effective search space used: 48616 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory