Align alpha-ketoglutarate TRAP transporter, solute receptor component (characterized)
to candidate WP_093392797.1 BM091_RS01090 TAXI family TRAP transporter solute-binding subunit
Query= reanno::psRCH2:GFF85 (317 letters) >NCBI__GCF_900114975.1:WP_093392797.1 Length = 336 Score = 163 bits (412), Expect = 6e-45 Identities = 116/332 (34%), Positives = 173/332 (52%), Gaps = 20/332 (6%) Query: 5 KRLGLLAAAAAFTAS-TAAVAAPTFINILTGGTSGVYYPIGVALSQQYNKIDGAKTSVQA 63 ++L +L A A + A A+ + I TGG GVYY G +++ +K + + Sbjct: 6 RKLTILIFALTLVAGFSQAEASKVRLVIGTGGLGGVYYYYGTTVAEIISKAGEFEATAMQ 65 Query: 64 TKASVENLNLLQAGRGE------LAFSLGDSVEDAWNGVEDAGFKAPLKRLRAIAGTYNN 117 T ASV+NL L+Q LA L DS A+ G + P K +R + Y N Sbjct: 66 TAASVDNLQLIQKRTDPEGNVYYLACVLPDSAYLAYTGQHEKFKDQPAKDVRILWTMYPN 125 Query: 118 YIQIVASAESGIKTLDDLKGKRISVGAPKSGTELNARAIFKAAGLDYKDMGRVEFLPYAE 177 Y+ IV SGI+T+ DLKGKR+S GAP SGTE+ A + +AAG+ D + E L +E Sbjct: 126 YLHIVTKEGSGIETVADLKGKRVSTGAPGSGTEVEAFMVLEAAGISTSDFAKHERLGASE 185 Query: 178 SVELIKNRQLDATLQSSGLGMAAIRDLASTM-----PVTFVEIPA--EVVEKIES---DA 227 S E + +DA S GL ++I +LA+T+ + + +PA ++V+ I S Sbjct: 186 SAEALSAGTIDAYFWSGGLPTSSITELATTLKRKGSKIKLIGLPADGDIVKNIASKFPGV 245 Query: 228 YLAGVIPAGTYDGQDADVPTVAITNILVTHEKVSDEVAYQMTKLMFDNLAALGNAHSAAK 287 I A Y G D PT+A N+ + + +EVAY++TK +F+ L L +A +K Sbjct: 246 CEPATIAASVY-GTSEDTPTLAFWNLFMGPASLPEEVAYKITKTVFEKLEELHSAVKPSK 304 Query: 288 DIKLENATKNL--PIPLHPGAERFYKEAGVLK 317 ENA K + IP HPG+ +++KE GVLK Sbjct: 305 ATTPENAVKFVGGTIPYHPGSLKYFKEIGVLK 336 Lambda K H 0.314 0.131 0.359 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 227 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 317 Length of database: 336 Length adjustment: 28 Effective length of query: 289 Effective length of database: 308 Effective search space: 89012 Effective search space used: 89012 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory