GapMind for catabolism of small carbon sources

 

Protein WP_092483062.1 in Desulfoscipio geothermicus DSM 3669

Annotation: NCBI__GCF_900115975.1:WP_092483062.1

Length: 400 amino acids

Source: GCF_900115975.1 in NCBI

Candidate for 51 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
L-proline catabolism opuBA med BusAA, component of Uptake system for glycine-betaine (high affinity) and proline (low affinity) (OpuAA-OpuABC) or BusAA-ABC of Lactococcus lactis). BusAA, the ATPase subunit, has a C-terminal tandem cystathionine β-synthase (CBS) domain which is the cytoplasmic K+ sensor for osmotic stress (osmotic strength)while the BusABC subunit has the membrane and receptor domains fused to each other (Biemans-Oldehinkel et al., 2006; Mahmood et al., 2006; Gul et al. 2012). An N-terminal amphipathic α-helix of OpuA is necessary for high activity but is not critical for biogenesis or the ionic regulation of transport (characterized) 55% 98% 427.6 OtaA, component of The salt-induced glycine betaine OtaABC transporter 62% 482.3
L-proline catabolism proV med glycine betaine/l-proline transport atp-binding protein prov (characterized) 50% 99% 380.2 OtaA, component of The salt-induced glycine betaine OtaABC transporter 62% 482.3
L-histidine catabolism hutV med ABC transporter for L-Histidine, ATPase component (characterized) 59% 96% 319.3 OtaA, component of The salt-induced glycine betaine OtaABC transporter 62% 482.3
L-proline catabolism hutV med HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized) 56% 96% 302.8 OtaA, component of The salt-induced glycine betaine OtaABC transporter 62% 482.3
putrescine catabolism potA lo spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 (characterized) 36% 83% 181 OtaA, component of The salt-induced glycine betaine OtaABC transporter 62% 482.3
D-maltose catabolism malK1 lo MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) 41% 64% 179.1 OtaA, component of The salt-induced glycine betaine OtaABC transporter 62% 482.3
trehalose catabolism thuK lo MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) 41% 64% 179.1 OtaA, component of The salt-induced glycine betaine OtaABC transporter 62% 482.3
D-maltose catabolism thuK lo Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized) 40% 65% 177.6 OtaA, component of The salt-induced glycine betaine OtaABC transporter 62% 482.3
D-cellobiose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 39% 62% 173.3 OtaA, component of The salt-induced glycine betaine OtaABC transporter 62% 482.3
D-glucose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 39% 62% 173.3 OtaA, component of The salt-induced glycine betaine OtaABC transporter 62% 482.3
lactose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 39% 62% 173.3 OtaA, component of The salt-induced glycine betaine OtaABC transporter 62% 482.3
D-maltose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 39% 62% 173.3 OtaA, component of The salt-induced glycine betaine OtaABC transporter 62% 482.3
sucrose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 39% 62% 173.3 OtaA, component of The salt-induced glycine betaine OtaABC transporter 62% 482.3
trehalose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 39% 62% 173.3 OtaA, component of The salt-induced glycine betaine OtaABC transporter 62% 482.3
D-xylose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 39% 62% 173.3 OtaA, component of The salt-induced glycine betaine OtaABC transporter 62% 482.3
D-galactose catabolism PfGW456L13_1897 lo ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 40% 58% 172.6 OtaA, component of The salt-induced glycine betaine OtaABC transporter 62% 482.3
L-arabinose catabolism xacK lo Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale) 34% 64% 169.1 OtaA, component of The salt-induced glycine betaine OtaABC transporter 62% 482.3
D-maltose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 34% 87% 166 OtaA, component of The salt-induced glycine betaine OtaABC transporter 62% 482.3
D-maltose catabolism musK lo ABC-type maltose transporter (EC 7.5.2.1) (characterized) 39% 60% 166 OtaA, component of The salt-induced glycine betaine OtaABC transporter 62% 482.3
sucrose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 34% 87% 166 OtaA, component of The salt-induced glycine betaine OtaABC transporter 62% 482.3
trehalose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 34% 87% 166 OtaA, component of The salt-induced glycine betaine OtaABC transporter 62% 482.3
trehalose catabolism treV lo TreV, component of Trehalose porter (characterized) 37% 76% 165.6 OtaA, component of The salt-induced glycine betaine OtaABC transporter 62% 482.3
L-arabinose catabolism xacJ lo Xylose/arabinose import ATP-binding protein XacJ; EC 7.5.2.13 (characterized, see rationale) 41% 58% 164.9 OtaA, component of The salt-induced glycine betaine OtaABC transporter 62% 482.3
L-fucose catabolism SM_b21106 lo ABC transporter for L-Fucose, ATPase component (characterized) 38% 64% 164.5 OtaA, component of The salt-induced glycine betaine OtaABC transporter 62% 482.3
D-maltose catabolism malK_Bb lo ABC-type maltose transport, ATP binding protein (characterized, see rationale) 34% 87% 164.1 OtaA, component of The salt-induced glycine betaine OtaABC transporter 62% 482.3
sucrose catabolism thuK lo ThuK aka RB0314 aka SMB20328, component of Trehalose/maltose/sucrose porter (trehalose inducible) (characterized) 32% 91% 164.1 OtaA, component of The salt-induced glycine betaine OtaABC transporter 62% 482.3
D-cellobiose catabolism msiK lo MsiK protein, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] (characterized) 33% 79% 163.7 OtaA, component of The salt-induced glycine betaine OtaABC transporter 62% 482.3
xylitol catabolism Dshi_0546 lo ABC transporter for Xylitol, ATPase component (characterized) 36% 76% 161.8 OtaA, component of The salt-induced glycine betaine OtaABC transporter 62% 482.3
D-cellobiose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 32% 73% 160.2 OtaA, component of The salt-induced glycine betaine OtaABC transporter 62% 482.3
D-galactose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 32% 73% 160.2 OtaA, component of The salt-induced glycine betaine OtaABC transporter 62% 482.3
D-glucosamine (chitosamine) catabolism SM_b21216 lo ABC transporter for D-Glucosamine, ATPase component (characterized) 37% 71% 160.2 OtaA, component of The salt-induced glycine betaine OtaABC transporter 62% 482.3
D-glucose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 32% 73% 160.2 OtaA, component of The salt-induced glycine betaine OtaABC transporter 62% 482.3
lactose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 32% 73% 160.2 OtaA, component of The salt-induced glycine betaine OtaABC transporter 62% 482.3
D-maltose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 32% 73% 160.2 OtaA, component of The salt-induced glycine betaine OtaABC transporter 62% 482.3
D-mannose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 32% 73% 160.2 OtaA, component of The salt-induced glycine betaine OtaABC transporter 62% 482.3
sucrose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 32% 73% 160.2 OtaA, component of The salt-induced glycine betaine OtaABC transporter 62% 482.3
trehalose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 32% 73% 160.2 OtaA, component of The salt-induced glycine betaine OtaABC transporter 62% 482.3
N-acetyl-D-glucosamine catabolism SMc02869 lo N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 38% 65% 159.1 OtaA, component of The salt-induced glycine betaine OtaABC transporter 62% 482.3
D-glucosamine (chitosamine) catabolism SMc02869 lo N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 38% 65% 159.1 OtaA, component of The salt-induced glycine betaine OtaABC transporter 62% 482.3
D-sorbitol (glucitol) catabolism mtlK lo ABC transporter for D-Sorbitol, ATPase component (characterized) 36% 64% 159.1 OtaA, component of The salt-induced glycine betaine OtaABC transporter 62% 482.3
D-cellobiose catabolism SMc04256 lo ABC transporter for D-Cellobiose and D-Salicin, ATPase component (characterized) 38% 61% 158.7 OtaA, component of The salt-induced glycine betaine OtaABC transporter 62% 482.3
trehalose catabolism malK lo MsmK aka SMU.882, component of The raffinose/stachyose transporter, MsmEFGK (MalK (3.A.1.1.27) can probably substitute for MsmK; Webb et al., 2008). This system may also transport melibiose, isomaltotriose and sucrose as well as isomaltosaccharides (characterized) 31% 81% 157.9 OtaA, component of The salt-induced glycine betaine OtaABC transporter 62% 482.3
D-maltose catabolism malK lo Maltose-transporting ATPase (EC 3.6.3.19) (characterized) 34% 65% 156.4 OtaA, component of The salt-induced glycine betaine OtaABC transporter 62% 482.3
D-mannitol catabolism mtlK lo ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component (characterized) 40% 59% 155.6 OtaA, component of The salt-induced glycine betaine OtaABC transporter 62% 482.3
D-maltose catabolism malK_Sm lo MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 35% 62% 153.3 OtaA, component of The salt-induced glycine betaine OtaABC transporter 62% 482.3
xylitol catabolism HSERO_RS17020 lo ABC-type sugar transport system, ATPase component protein (characterized, see rationale) 36% 59% 144.4 OtaA, component of The salt-induced glycine betaine OtaABC transporter 62% 482.3
glycerol catabolism glpS lo ABC transporter for Glycerol, ATPase component 1 (characterized) 32% 66% 135.6 OtaA, component of The salt-induced glycine betaine OtaABC transporter 62% 482.3
L-isoleucine catabolism livG lo High-affinity branched-chain amino acid transport ATP-binding protein LivG aka B3455, component of Leucine; leucine/isoleucine/valine porter (characterized) 31% 89% 115.5 OtaA, component of The salt-induced glycine betaine OtaABC transporter 62% 482.3
L-leucine catabolism livG lo High-affinity branched-chain amino acid transport ATP-binding protein LivG aka B3455, component of Leucine; leucine/isoleucine/valine porter (characterized) 31% 89% 115.5 OtaA, component of The salt-induced glycine betaine OtaABC transporter 62% 482.3
L-phenylalanine catabolism livG lo High-affinity branched-chain amino acid transport ATP-binding protein LivG aka B3455, component of Leucine; leucine/isoleucine/valine porter (characterized) 31% 89% 115.5 OtaA, component of The salt-induced glycine betaine OtaABC transporter 62% 482.3
L-valine catabolism livG lo High-affinity branched-chain amino acid transport ATP-binding protein LivG aka B3455, component of Leucine; leucine/isoleucine/valine porter (characterized) 31% 89% 115.5 OtaA, component of The salt-induced glycine betaine OtaABC transporter 62% 482.3

Sequence Analysis Tools

View WP_092483062.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MAKVIVENLVKIFGDNPGKALKMLEEGKSKQEILEATRCTVGVYNISFEVQEGETFVLMG
LSGSGKSTLLRCLNRLIEPTDGKILIDGEEITGVDDKKLRQIRRNKLGMVFQRFALFPHR
TVVDNVAYGLEVQGMEKEERLEKARRVLEVVGLKEWENSMPSQLSGGMQQRVGLARALAS
DPDILLMDEAFSALDPLIRKGMQDELLSLQATLNKTIIFVTHDLDEALKIGDRIALMKDG
AIIQIGTSEEILTNPANEYVEKFVEDVDMSKVLTAEGVMKKPDAVVTLKDGPRQAMRRMK
ENGISSIFVVTRDRKLSGLVMAEDALNAVEAHQDHLDEIIIKDIPRVSPDTPLTDLIPII
AESRYPIAVVDEQNHLKGIIVRGAVLAGMVRKGDNGQDVA

This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory