Align BadK (characterized)
to candidate WP_092481562.1 BM299_RS00820 enoyl-CoA hydratase-related protein
Query= metacyc::MONOMER-943 (258 letters) >NCBI__GCF_900115975.1:WP_092481562.1 Length = 260 Score = 172 bits (437), Expect = 5e-48 Identities = 103/256 (40%), Positives = 147/256 (57%), Gaps = 10/256 (3%) Query: 6 ILTETQGRVGIITLNRPDVLNALNDALMDALGGALLAFDADDGIGAIVIAG-NTRAFAAG 64 I+ E + + IIT+NRP VLNALN + LG A+ + ++GI I++ G ++F AG Sbjct: 6 IIIEKEDNIAIITINRPKVLNALNYETVMELGNAISQLENENGIKVIILTGAGEKSFVAG 65 Query: 65 ADIASMAAWSYSDV-----YGSNFITRNWETIRQIRKPVLAAVAGLAYGGGCELALACDI 119 ADIA M + + YG + +++ I KPV+AA+ G A GGGCELA+ACDI Sbjct: 66 ADIAYMQNLTPLEAKKFARYGQSVLSK----IENFPKPVIAAINGYALGGGCELAMACDI 121 Query: 120 VIAGRSAKFALPEIKLGLLPGAGGTQRLPRAIGKAKAMDMCLSARPLNAEEADRYGLVSR 179 IA +AKF PE+ LGL+ G GGTQRL R + A ++ L+A +AE A ++GLV+ Sbjct: 122 RIASSNAKFGQPEVNLGLIAGFGGTQRLTRLVNPGLAKEILLTANVYDAEAACKFGLVNH 181 Query: 180 VVDDDRLRDETVALATTIAAFSAPALMALKESLNRAFESTLAEGILFERRELHARFASAD 239 VV+ L + +A+ IA+ A+ KE++N E L + + E FA+ D Sbjct: 182 VVEPGELMNYCKKMASVIASRGPIAVQLTKEAINDGLEMDLEKALAHEADLFAIVFATKD 241 Query: 240 AREGIQAFLEKRAPCF 255 EGI AFL KR P F Sbjct: 242 KEEGISAFLSKRKPEF 257 Lambda K H 0.321 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 111 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 260 Length adjustment: 24 Effective length of query: 234 Effective length of database: 236 Effective search space: 55224 Effective search space used: 55224 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory