Align D-2-hydroxyacid dehydrogenase (NAD+) (EC 1.1.1.345) (characterized)
to candidate WP_092482325.1 BM299_RS04760 hydroxyacid dehydrogenase
Query= BRENDA::Q1GAA2 (333 letters) >NCBI__GCF_900115975.1:WP_092482325.1 Length = 330 Score = 121 bits (304), Expect = 2e-32 Identities = 85/278 (30%), Positives = 137/278 (49%), Gaps = 33/278 (11%) Query: 71 VKCIGLRIVGFNTINFDWTKKYNLLVTNVPVYSPRAIAEMTVTQAMYLLRKIGEFRYRMD 130 +K IG +G + I+ +Y + V N P + ++AE + +YL +++ E + Sbjct: 64 LKVIGRHGMGLDNIDLKAADQYGVAVVNTPDANVLSVAEHVLATMLYLCKRLKEVDNAL- 122 Query: 131 HDHDFTWPSNL---------ISNEIYNLTVGLIGVGHIGSAVAEIFS-AMGAKVIAYDVA 180 +F P +L + E+Y T+GL+GVG I +AEI + +V YD Sbjct: 123 RTGEFDRPGSLPGLVTKLGYTTQELYGKTLGLVGVGKIARRIAEICTKGFDMQVCGYDAY 182 Query: 181 YNPEF------EPFLTYTDFDTVLKEADIVSLHTPLFPSTENMIGEKQLKEMKKSAYLIN 234 P+ EP + V ++AD +S+H PL P T +IG+KQL MK +A+LIN Sbjct: 183 LAPDVIQQAGVEPC---GSLEEVFEKADFISVHVPLTPGTRGLIGKKQLDLMKPTAFLIN 239 Query: 235 CARGELVDTGALIKALQDGEIAGAGLDTLAGESSYFGHTGLTDSEIPEDYKTLAKMPNVV 294 ARG +V+ L +AL++ IAGA +D A E P L + NVV Sbjct: 240 SARGGVVNEDDLYQALKEKSIAGAAVDVFA-------------QEPPGKNHPLFTLDNVV 286 Query: 295 ITPHSAFYTETSIRNMVQICLTDQLTIAKGGRPRSIVN 332 +TPH A T+ ++ M + +++ +G RP+ +VN Sbjct: 287 VTPHIAAMTDGALVRMARDVAEGVVSVLRGERPKYLVN 324 Lambda K H 0.318 0.135 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 225 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 333 Length of database: 330 Length adjustment: 28 Effective length of query: 305 Effective length of database: 302 Effective search space: 92110 Effective search space used: 92110 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory