Align D-lactate transporter, ATP-binding component (characterized)
to candidate WP_207545213.1 BM299_RS15860 urea ABC transporter ATP-binding protein UrtD
Query= reanno::Phaeo:GFF1248 (251 letters) >NCBI__GCF_900115975.1:WP_207545213.1 Length = 248 Score = 183 bits (465), Expect = 3e-51 Identities = 99/247 (40%), Positives = 156/247 (63%), Gaps = 7/247 (2%) Query: 3 ILEVKNVGKRFGGLQALSDVNLSVRENTVHAIIGPNGAGKSTLLNCLVGKLIPDTGSVMF 62 +LE+K++ F G +A++DV+ +V++ +H IGPNGAGK+TLL+ + G++ P GS+ F Sbjct: 4 VLEIKDLTVSFDGFKAVNDVSTAVKKGDIHFFIGPNGAGKTTLLDAICGRVKPAAGSIFF 63 Query: 63 -DGKSVLGRAPYEINQMGISRVFQTPEIFGDLSVLENMMIPCFAKRDGAFEMNAISAVSG 121 D V A +EI + GI R FQ P +F ++V ENM + KR S +S Sbjct: 64 KDCGDVTKLAEHEIVERGIGRKFQVPSVFNSITVFENMELAAEKKR--TIFSTLFSKLSQ 121 Query: 122 QRDILEKAEHMLEEMNMADKRHMNAASMSRGDKRRLEIGMCLSQEPRLLLLDEPTAGMAR 181 ++ +E+ E++L + + +KR A++S G+K+ LEIGM Q+P ++LLDEP AGM R Sbjct: 122 EQ--MERIEYVLNIIGLYEKRFEKPAALSHGEKQWLEIGMLFVQQPEIMLLDEPVAGMGR 179 Query: 182 ADTNNTIDLLKQIKSERDITIAIIEHDMHVVFSLADRITVLAQGTPLVEDDPQNIKGNPK 241 +T+ T +LLK+I +D ++ ++EHDM V A +TVL +GT LVE D + ++ +P+ Sbjct: 180 KETDKTGELLKEI--AKDCSVVVVEHDMDFVRDFASTVTVLHEGTLLVEGDMEEVQKDPR 237 Query: 242 VREAYLG 248 V E YLG Sbjct: 238 VIEVYLG 244 Lambda K H 0.318 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 164 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 251 Length of database: 248 Length adjustment: 24 Effective length of query: 227 Effective length of database: 224 Effective search space: 50848 Effective search space used: 50848 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory