Align C4-dicarboxylate-binding periplasmic protein DctP (characterized)
to candidate WP_092483299.1 BM299_RS09265 TRAP transporter substrate-binding protein
Query= SwissProt::P37735 (333 letters) >NCBI__GCF_900115975.1:WP_092483299.1 Length = 343 Score = 168 bits (426), Expect = 2e-46 Identities = 95/302 (31%), Positives = 163/302 (53%), Gaps = 10/302 (3%) Query: 29 IVIKFSHVVAPDTPKGKGAAKFEELAEKYTNGAVDVEVYPNSQLYKDKEELEALQLGAVQ 88 I++K H VA P G KF+++ E+ T G V +++Y N + +++ +E LQLG + Sbjct: 41 IILKAGHAVAESHPYHLGLEKFKQIVEEKTGGQVQIDIYANGTIGSERDMIEGLQLGTID 100 Query: 89 MLAPSLAKFGPL--GVQDFEVFDLPYIFKDYEALHKVTQGEAGKMLLSKLEAKGITGLAF 146 ++ L GP+ V + V DLP++F E ++V GE G+ LL + GI GLAF Sbjct: 101 LV---LTSTGPVINFVPEMGVVDLPFLFSSREHAYQVLDGEIGQDLLEQFGDIGIVGLAF 157 Query: 147 WDNGFK-IMSANTPLTMPDDFLGLKMRIQSSKVLEAEMNALGAVPQVMAFSEVYQALQTG 205 W+NGF+ + ++ P+ +D GLK+R ++V +A LGA P MA+ EVY ALQ Sbjct: 158 WENGFRNLTNSERPINSVEDIQGLKIRTMENEVHQAAFKELGADPTPMAWGEVYTALQQK 217 Query: 206 VVDGTENPPSNMFTQKMNEVQKHATVSNHGYLGYAVIVNKQFWDGLPADVRTGLEKAMAE 265 +DG ENP ++ K+ EVQK+ ++ H Y +++ ++ D L + + ++KA E Sbjct: 218 TIDGQENPIPIIYNMKIYEVQKYLALTGHFYSPALLLIGQKSLDKLSPEQQNIIKKAAVE 277 Query: 266 STDYANGIAKEENEKALQAMKDAGTTEFHELTAEERAAWEEVLTPVHDEMAERIGAETIA 325 + Y K + ++ L +++ G +T ++ A E V+++ R G +TI Sbjct: 278 AATYEREQIKVQEDEQLAKLEEKGMV----ITRPDKNALREATMAVYEKYEGRFGKDTIQ 333 Query: 326 AV 327 + Sbjct: 334 KI 335 Lambda K H 0.314 0.130 0.364 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 233 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 333 Length of database: 343 Length adjustment: 28 Effective length of query: 305 Effective length of database: 315 Effective search space: 96075 Effective search space used: 96075 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory