Align succinylornithine transaminase (EC 2.6.1.81) (characterized)
to candidate WP_092482996.1 BM299_RS08235 acetylornithine transaminase
Query= BRENDA::O30508 (406 letters) >NCBI__GCF_900115975.1:WP_092482996.1 Length = 396 Score = 381 bits (978), Expect = e-110 Identities = 192/384 (50%), Positives = 247/384 (64%), Gaps = 4/384 (1%) Query: 14 DRYMVPNYAPAAFIPVRGEGSRVWDQSGRELIDFAGGIAVTSLGHAHPALVKALTEQAQR 73 D+Y++ Y PVRGEG+R+WD GRE +DF GGIAV SLGH HPA+V+A+ EQA R Sbjct: 11 DQYVMHTYGRIGLAPVRGEGARLWDADGREFLDFVGGIAVNSLGHCHPAVVRAIQEQAAR 70 Query: 74 IWHVSNVFTNEPALRLARKLVDATFAERVFLANSGAEANEAAFKLARRYANDVYGPQKYE 133 + HVSN++ EP RLA LV + +RVF NSGAEANE A KLAR++A +G KYE Sbjct: 71 LMHVSNLYYIEPQARLAELLVQNSCCDRVFFCNSGAEANEGAIKLARKWAKKQHGADKYE 130 Query: 134 IIAASNSFHGRTLFTVNVGGQPKYSDGFGPKFEGITHVPYNDLEALKAAISDKTCAVVLE 193 II A SFHGRTL + GQPKY GF P G +VP+ND +AL+ AI TCAV+LE Sbjct: 131 IITAEKSFHGRTLAAITATGQPKYQQGFEPLPPGFKYVPFNDPDALERAIGPHTCAVMLE 190 Query: 194 PIQGEGGVLPAQQAYLEGARKLCDEHNALLVFDEVQSGMGRVGELFAYMHYGVVPDILSS 253 P+QGEGGV A YL G R+LCD + LLVFDEVQ G+GR GE AY HY V PDI++ Sbjct: 191 PVQGEGGVYAAASEYLAGVRELCDRNGLLLVFDEVQCGLGRTGEFLAYQHYDVEPDIITL 250 Query: 254 AKSLGGGFPIGAMLTTGEIAKHLSVGTHGTTYGGNPLASAVAEAALDVINTPEVLDGVKA 313 AK+LGGGFPIGAML +A + G H TT+GGNPLA A AA+ + V+ +A Sbjct: 251 AKALGGGFPIGAMLAKETVAAAFAPGDHATTFGGNPLACAAGLAAMQTMLGDGVMQNCRA 310 Query: 314 KHERFKSRLQKIGQEYGIFDEIRGMGLLIGAALTDEWKGKARDVLNAAEKEAVMVLQASP 373 FK +LQ + ++Y E+RG+GLL+G E D++N ++ +++ + Sbjct: 311 VGAYFKEKLQDLARKYDFIKEVRGLGLLLGM----ELNRPGGDIVNRCREKGLLINCVNN 366 Query: 374 DVVRFAPSLVIDDAEIDEGLERFE 397 +V+RF P LVI E+D LE E Sbjct: 367 NVLRFTPPLVIGTEEVDRALETVE 390 Lambda K H 0.318 0.135 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 444 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 396 Length adjustment: 31 Effective length of query: 375 Effective length of database: 365 Effective search space: 136875 Effective search space used: 136875 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory