Align putrescine-2-oxoglutarate transaminase (EC 2.6.1.82) (characterized)
to candidate WP_245779653.1 BM299_RS04985 aspartate aminotransferase family protein
Query= BRENDA::P42588 (459 letters) >NCBI__GCF_900115975.1:WP_245779653.1 Length = 471 Score = 332 bits (851), Expect = 2e-95 Identities = 179/389 (46%), Positives = 249/389 (64%), Gaps = 32/389 (8%) Query: 78 DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPLHSQELLDPLRAMLAKTLAALT 137 D++G ++D LGG+G N+GH +P V+ AV+ Q+ + P Q + + A L LA +T Sbjct: 64 DSEGNAYLDFLGGYGSLNIGHNHPRVIEAVE-QVRELPNILQASIPTITAALLHNLAVIT 122 Query: 138 PGKLKYSFFCNSGTESVEAALKLAKAYQSPRGKFTFIATSGAFHGKSLGALSATAKSTFR 197 PGKLK SF CNSG E+VE ALKLA+A G+ TFI +FHGKS GALS T + +R Sbjct: 123 PGKLKRSFLCNSGAEAVEGALKLARA---ATGRKTFIYCRNSFHGKSFGALSVTGREKYR 179 Query: 198 KPFMPLLPGFRHVPFGNIEAMRTALNECKKTGDDVAAVILEPIQGEGGVILPPPGYLTAV 257 + F PLL R VPFG+I+A+R AL + + AA I+EP+QGEGG+ +PP GYL+ Sbjct: 180 ELFEPLLFDCREVPFGDIDALRKALRKYQ-----AAAFIVEPVQGEGGINMPPRGYLSEA 234 Query: 258 RKLCDEFGALMILDEVQTGMGRTGKMFACEHENVQPDILCLAKALGGGVMPIGATIATEE 317 + C + G L I DE+QTG GRTG MFAC+HENV+PD++CLAK+LGGG+MPIGA I ++ Sbjct: 235 ARACRDAGTLFIADEIQTGFGRTGAMFACQHENVEPDVMCLAKSLGGGIMPIGAFITNDD 294 Query: 318 VFSVLF---DNPFLHTTTFGGNPLACAAALATINVLLEQNLPAQAEQKGDMLLDGFRQLA 374 ++ + + LHT+TFGGN A AA +A I VL+++ LPA A +KG + G R L Sbjct: 295 IWQKAYGSVEKATLHTSTFGGNTWAAAAGIAAIEVLVKEKLPAAAAEKGTYFISGLRDLQ 354 Query: 375 REYPDLVQEARGKGMLMAIEF-----VDNEIGYNFASEMF--------------RQRVLV 415 ++YP L+QE RG+G+L+ IE + N+ AS++ R R++ Sbjct: 355 KKYP-LLQEVRGQGLLIGIELAQPGGLTNKATMGLASKLSHEYLGSMVAGELLNRHRIIT 413 Query: 416 AGTLNNAKTIRIEPPLTLTIEQCELVIKA 444 A TLNN IR+EPPLT+T E+ + V+ A Sbjct: 414 AYTLNNPNVIRMEPPLTVTGEELDYVLNA 442 Lambda K H 0.320 0.135 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 555 Number of extensions: 29 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 459 Length of database: 471 Length adjustment: 33 Effective length of query: 426 Effective length of database: 438 Effective search space: 186588 Effective search space used: 186588 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory