Align ABC transporter for L-Arginine and L-Citrulline, permease component 1 (characterized)
to candidate WP_092487756.1 BM299_RS18040 amino acid ABC transporter permease
Query= reanno::pseudo3_N2E3:AO353_03045 (232 letters) >NCBI__GCF_900115975.1:WP_092487756.1 Length = 234 Score = 132 bits (331), Expect = 8e-36 Identities = 76/229 (33%), Positives = 127/229 (55%), Gaps = 11/229 (4%) Query: 6 NVIWEALP-LYFGGLVTTLKLLALSLLFGLLAALPLGLMRVSKQPIVNMSAWLYTYVIRG 64 +V+ E LP L F G TL++ +S+ G L L GL R+S++ ++ A Y RG Sbjct: 2 DVVIENLPVLIFQGAKITLQITIISVAIGCLLGLIGGLSRLSRRKVLRFLATAYVDFFRG 61 Query: 65 TPMLVQLFLIYYGLAQFEAVRESFL------WPWLSSATF----CACLAFAINTSAYTAE 114 TP+LVQ+F++Y+G+ + +SF+ P S A +A ++N+ AY AE Sbjct: 62 TPLLVQIFIVYFGIPKLLMDLQSFMVDSYGMTPVADSFALPRFLAAVIACSLNSGAYVAE 121 Query: 115 IIAGSLRATPNGEIEAAKAMGMSRFKMYKRILLPSALRRALPQYSNEVIMMLQTTSLASI 174 I +++ G++EAA+++GM+ + + ++LP A +R +P NE I ML+ TSL S+ Sbjct: 122 IFRAGVQSIERGQMEAARSLGMTHGQAMRYVILPQAFKRVIPPLGNEFIAMLKDTSLLSV 181 Query: 175 VTLIDITGAARTVNAQYYLPFEAYITAGVFYLCMTFILVRLFKMAEHRW 223 + ++T + + A+ Y F ++T G YL MTF L R+ E R+ Sbjct: 182 IGFAELTRNGQLIIARTYESFAIWLTVGFIYLIMTFTLSRIVDYLERRY 230 Lambda K H 0.329 0.139 0.427 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 114 Number of extensions: 3 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 232 Length of database: 234 Length adjustment: 23 Effective length of query: 209 Effective length of database: 211 Effective search space: 44099 Effective search space used: 44099 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory