Align 4-aminobutyrate-2-oxoglutarate transaminase (EC 2.6.1.19) (characterized)
to candidate WP_092481894.1 BM299_RS02515 putrescine aminotransferase
Query= BRENDA::Q0K2K2 (423 letters) >NCBI__GCF_900115975.1:WP_092481894.1 Length = 453 Score = 204 bits (519), Expect = 4e-57 Identities = 147/397 (37%), Positives = 210/397 (52%), Gaps = 29/397 (7%) Query: 34 ATLWDVEGRAYTDFAAGIAVLNTGHRHPRVMQAIAAQLERFT-HTAYQIVPYQGYVTLAE 92 +T D+ G+ + D G + N GHRHP+V++A+ QL+R H+ + P + + LA+ Sbjct: 69 STFTDIWGKEFIDCLGGYGIYNVGHRHPKVLKAVMDQLQRQALHSQELLDPLRAF--LAK 126 Query: 93 RINALVPIQGLNKTALFTTGAEAVENAIKIARAHTGRPGVIAFSGAFHGRTLLGMALTGK 152 + ++ P L +G E+VE IK A+ +TGR I+ + AFHG++L ++ T K Sbjct: 127 LLGSITP-GDLQYAFFVNSGTESVEAGIKFAKMYTGRRSFISTTRAFHGKSLGSLSATAK 185 Query: 153 VAPYKIGFGPFPSDIYHAPFPSALHGVSTERALQALEGLFKTDIDPARVAAIIVEPVQGE 212 ++ F P +H P+ +A E LE D VAA+IVEPVQGE Sbjct: 186 -GVFRKPFLPLIPGFHHVPYGNA------EAVEMMLESCAFVGED---VAAVIVEPVQGE 235 Query: 213 GGFQAAPADFMRGLRAVCDQHGIVLIADEVQTGFGRTGKMFAMSHHDVEPDLITMAKSLA 272 GG P D++ LR +CD++G +LI DEVQTG GRTGKMFA H +V PD++ +AK+ Sbjct: 236 GGVIIPPEDYLPKLRELCDKYGALLILDEVQTGMGRTGKMFACEHSNVVPDILCLAKAFG 295 Query: 273 GG-MPLSAVSGRAAIMDAPL--PGGLGGTYAGNPLAVAAAHAVIDVIEEEKLCERSASLG 329 GG MP+ A R + + + P T+ GNP+ AAA A I+V+ EE L +RSA G Sbjct: 296 GGIMPIGATVARKPMWEKLVENPFLHTTTFGGNPVCCAAAIANINVLLEENLPQRSAESG 355 Query: 330 QQLREHLLAQRKHCPAMA-EVRGLGSMVAAEFCDPATGQPSAEHAKRVQTRALEAGLVLL 388 + L + PA+ EVRG G M+ EF + G E AK + R +L Sbjct: 356 VYMLGKLRELAEKYPAVVQEVRGKGLMIGIEFFNDELGY---EVAKGLFARG------VL 406 Query: 389 TCGTYGNV--IRFLYPLTIPQAQFDAALAVLTQALAE 423 GT N IR PLTI + Q D + L LAE Sbjct: 407 VAGTLINAKSIRIEPPLTISREQQDQVIERLDNTLAE 443 Lambda K H 0.321 0.136 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 448 Number of extensions: 24 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 423 Length of database: 453 Length adjustment: 32 Effective length of query: 391 Effective length of database: 421 Effective search space: 164611 Effective search space used: 164611 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory