Align ABC transporter for L-Fucose, ATPase component (characterized)
to candidate WP_092484009.1 BM299_RS11075 ABC transporter ATP-binding protein
Query= reanno::Smeli:SM_b21106 (365 letters) >NCBI__GCF_900115975.1:WP_092484009.1 Length = 344 Score = 199 bits (506), Expect = 9e-56 Identities = 104/263 (39%), Positives = 161/263 (61%), Gaps = 8/263 (3%) Query: 22 IDLEVKDREFIALVGPSGCGKSTTLRMIAGLEEVSGGAIEIGGRKVNDLPPRARNISMVF 81 I+LEV++ E+ ++GP+G GK+ L IAG+ G I R + L P R + V+ Sbjct: 19 INLEVQEGEYFIILGPTGTGKTVILETIAGMYRPDKGTIRFKERNLATLAPEQRKVGFVY 78 Query: 82 QSYALYPHMTVAENMGFSLKIAGRPAEEIKTRVAEAAAILDLAHLLERRPSQLSGGQRQR 141 Q YAL+PH+TV EN+ F +I P + IK+++ E A+L + HLL R PS LSGG++QR Sbjct: 79 QDYALFPHLTVKENIIFGAQIRKLPKKIIKSKLDELVAMLGIGHLLNRHPSTLSGGEQQR 138 Query: 142 VAMGRAIVRQPDVFLFDEPLSNLDAKLRTQVRTEIKKLHARMQATMIYVTHDQVEAMTLS 201 A+ RA++ P++ L DEPLS LD + + + E+KK+H ++ T ++VTHD EAM L+ Sbjct: 139 TALARALIISPEILLLDEPLSALDPRSKENFQEELKKIHQTLKTTTLHVTHDFNEAMYLA 198 Query: 202 DRIVIMRDGHIEQVGTPEDVFRRPATKFVAGFIGSPPMNMEEAVLTDGKLAFASGATLPL 261 D+I +M G I QVGTP+++F +P FVA F+G N+ E + D K++ A + Sbjct: 199 DKIGVMHQGQIIQVGTPQEIFYKPQNDFVASFVGIE--NIFEGQVNDDKVSLAPDVDI-- 254 Query: 262 PPRFRSLVREGQKVTFGLRPDDV 284 F + ++G KV + P+D+ Sbjct: 255 ---FVNTGKQG-KVKVAVPPEDI 273 Lambda K H 0.320 0.137 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 294 Number of extensions: 14 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 365 Length of database: 344 Length adjustment: 29 Effective length of query: 336 Effective length of database: 315 Effective search space: 105840 Effective search space used: 105840 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory