Align Solute-binding protein Bpro_3107 (characterized)
to candidate WP_092483299.1 BM299_RS09265 TRAP transporter substrate-binding protein
Query= SwissProt::Q128M1 (330 letters) >NCBI__GCF_900115975.1:WP_092483299.1 Length = 343 Score = 174 bits (440), Expect = 4e-48 Identities = 94/289 (32%), Positives = 164/289 (56%), Gaps = 1/289 (0%) Query: 26 GAAQATEFRSADTHNADDYPTVAAVKYMGELLEKKSGGKHKIKVFNKQALGSEKETIDQV 85 G A+ A A+ +P ++ +++E+K+GG+ +I ++ +GSE++ I+ + Sbjct: 35 GEAEGKIILKAGHAVAESHPYHLGLEKFKQIVEEKTGGQVQIDIYANGTIGSERDMIEGL 94 Query: 86 KIGALDFTRVNVGPMNAICPLTQVPTMPFLFSSIAHMRKSLDGPVGDEILKSCESAGFIG 145 ++G +D + GP+ P V +PFLFSS H + LDG +G ++L+ G +G Sbjct: 95 QLGTIDLVLTSTGPVINFVPEMGVVDLPFLFSSREHAYQVLDGEIGQDLLEQFGDIGIVG 154 Query: 146 LAFYDSGARSIY-AKKPIRTVADAKGLKIRVQQSDLWVALVSAMGANATPMPYGEVYTGL 204 LAF+++G R++ +++PI +V D +GLKIR ++++ A +GA+ TPM +GEVYT L Sbjct: 155 LAFWENGFRNLTNSERPINSVEDIQGLKIRTMENEVHQAAFKELGADPTPMAWGEVYTAL 214 Query: 205 KTGLIDAAENNIPSFDTAKHVEAVKVYSKTEHSMAPEILVMSKIIYDKLPKAEQDMIRAA 264 + ID EN IP K E K + T H +P +L++ + DKL +Q++I+ A Sbjct: 215 QQKTIDGQENPIPIIYNMKIYEVQKYLALTGHFYSPALLLIGQKSLDKLSPEQQNIIKKA 274 Query: 265 AKESVAFERQKWDEQEAKSLANVKAAGAEIVEVDKKSFQAVMGPVYDKF 313 A E+ +ER++ QE + LA ++ G I DK + + VY+K+ Sbjct: 275 AVEAATYEREQIKVQEDEQLAKLEEKGMVITRPDKNALREATMAVYEKY 323 Lambda K H 0.316 0.130 0.362 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 230 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 330 Length of database: 343 Length adjustment: 28 Effective length of query: 302 Effective length of database: 315 Effective search space: 95130 Effective search space used: 95130 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory