Align GtrB aka SLL1103, component of Tripartite glutamate:Na+ symporter (characterized)
to candidate WP_092483916.1 BM299_RS10925 TRAP transporter large permease
Query= TCDB::P74224 (445 letters) >NCBI__GCF_900115975.1:WP_092483916.1 Length = 436 Score = 213 bits (541), Expect = 1e-59 Identities = 140/439 (31%), Positives = 219/439 (49%), Gaps = 28/439 (6%) Query: 24 PVAFSLGGVAILFAII--------GAALGSFDPIFLSAMPQRIFGIMANGTLLA------ 69 P L G+ FA++ AL F L A P F ++A T L Sbjct: 3 PQFVGLAGILAFFALLILRMPIAYAMALVGFAGFSLLASPTAAFSMVAKETYLTFSSYSL 62 Query: 70 --IPFFIFLGSMLERSGIAEQLLETMGIILGHLRGGLALAVILVGTMLAATTGVVAATVV 127 I F+++G + SGI +L ++GH GLA+A + A G AT Sbjct: 63 SVIAMFVWMGFLAYYSGIGSRLYVLAYKLIGHYPAGLAIATQAACAVFGAICGSNTATAA 122 Query: 128 AMGLISLPIMLRYGYSKELASGVIVASGTLGQIIPPSVVLIVLADQLGVSVGDLFIGSLL 187 MG I+LP M +Y Y LA+ + A G LG +IPPSV++IV SVG LF+ ++ Sbjct: 123 TMGAIALPEMKKYKYDISLATASVAAGGVLGVLIPPSVIMIVYGMATEQSVGKLFMAGIV 182 Query: 188 PGLMMAGSFALYVLIIAWLKPDLAPALPAEVRNIGGQELRRRIVQVMLPPLVLILLVLGS 247 PG+++ + + I+A PDL PA P G +E + + L++ L +G Sbjct: 183 PGMLLMALYMAAIFILAARNPDLGPAGP----KAGWEERINALRGGLGEVLIVFSLSIGG 238 Query: 248 IFFGIASPTEAGAVGSIGAIALAHFNQRLNWKALWEVCDATLRITSMVMLILLGSTAFSL 307 +F G +PTEAGAVG+ G +A+A +RLNW+ + R T+M+ML++ G+ F Sbjct: 239 LFAGWFTPTEAGAVGAAGVLAVALVKKRLNWEGFKKSLFDATRTTAMIMLMVAGAVIFG- 297 Query: 308 VFRGLEGDRFMFDL---LANLPGGQIGFLAISMITIFILGFFIDFFEIAFIVLPLFKPVA 364 R + R F+L LP +A+ ++ +LG FID + + +P+F PVA Sbjct: 298 --RFMAISRVPFELANWAGALPFPPFVIMAVILLIYLVLGCFIDALALVLLTIPIFYPVA 355 Query: 365 -EALNLDLIWYGVIVGANLQTSFLTPPFGFALFYLRGVAPASLTTGQIYRGAVPFIGLQV 423 L D IW+GVI+ + +TPP G ++ ++GVAP + I++G PF+ V Sbjct: 356 VTTLGYDPIWFGVIIVMVVAMGVITPPVGMNVYVIKGVAP-DIPLETIFKGIWPFLLALV 414 Query: 424 LVLLLIIIFPALINWLPSL 442 + L ++I FP + +LP++ Sbjct: 415 ICLGILIAFPQIATFLPNI 433 Lambda K H 0.331 0.148 0.443 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 575 Number of extensions: 43 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 445 Length of database: 436 Length adjustment: 32 Effective length of query: 413 Effective length of database: 404 Effective search space: 166852 Effective search space used: 166852 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory