Align ABC transporter for L-Histidine, permease component 1 (characterized)
to candidate WP_092487756.1 BM299_RS18040 amino acid ABC transporter permease
Query= reanno::acidovorax_3H11:Ac3H11_2554 (222 letters) >NCBI__GCF_900115975.1:WP_092487756.1 Length = 234 Score = 185 bits (470), Expect = 5e-52 Identities = 95/223 (42%), Positives = 146/223 (65%), Gaps = 20/223 (8%) Query: 15 LLAGALVTVEITAASLLLGCVMGLLVGIGRLNPKRRVVYALCTAYVAAIRGTPLLVQLFI 74 + GA +T++IT S+ +GC++GL+ G+ RL+ +R+V+ L TAYV RGTPLLVQ+FI Sbjct: 12 IFQGAKITLQITIISVAIGCLLGLIGGLSRLS-RRKVLRFLATAYVDFFRGTPLLVQIFI 70 Query: 75 LFFGLPQF-------------------GILLPAFVCGVIGLGIYSGAYVSEVVRGAIQSI 115 ++FG+P+ LP F+ VI + SGAYV+E+ R +QSI Sbjct: 71 VYFGIPKLLMDLQSFMVDSYGMTPVADSFALPRFLAAVIACSLNSGAYVAEIFRAGVQSI 130 Query: 116 DKGQMEAARSIGMSSGLAMRTVVLPQAVVRMIPPLGNEFIALIKNSALVSLLTIHDLMHE 175 ++GQMEAARS+GM+ G AMR V+LPQA R+IPPLGNEFIA++K+++L+S++ +L Sbjct: 131 ERGQMEAARSLGMTHGQAMRYVILPQAFKRVIPPLGNEFIAMLKDTSLLSVIGFAELTRN 190 Query: 176 GQKIISVSYRSLEVYLAIAVVYFILTGATTLVLRRIELRLRAG 218 GQ II+ +Y S ++L + +Y I+T + ++ +E R + G Sbjct: 191 GQLIIARTYESFAIWLTVGFIYLIMTFTLSRIVDYLERRYKTG 233 Lambda K H 0.328 0.143 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 154 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 222 Length of database: 234 Length adjustment: 23 Effective length of query: 199 Effective length of database: 211 Effective search space: 41989 Effective search space used: 41989 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory