Align monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized)
to candidate WP_092484009.1 BM299_RS11075 ABC transporter ATP-binding protein
Query= BRENDA::Q97UY8 (353 letters) >NCBI__GCF_900115975.1:WP_092484009.1 Length = 344 Score = 203 bits (516), Expect = 6e-57 Identities = 120/307 (39%), Positives = 184/307 (59%), Gaps = 15/307 (4%) Query: 14 KKGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDRLVASNG 73 K G+ LD +N+ ++ GE F ILGP+G GKT + IAG+ P G + F +R +A+ Sbjct: 10 KLGEFQLLD-INLEVQEGEYFIILGPTGTGKTVILETIAGMYRPDKGTIRFKERNLAT-- 66 Query: 74 KLIVPPEDRKIGMVFQTWALYPNLTAFENIAFPLTNMKMSKEEIRKRVEEVAKILDIHHV 133 + PE RK+G V+Q +AL+P+LT ENI F K+ K+ I+ +++E+ +L I H+ Sbjct: 67 ---LAPEQRKVGFVYQDYALFPHLTVKENIIFGAQIRKLPKKIIKSKLDELVAMLGIGHL 123 Query: 134 LNHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVQSRLGVT 193 LN P LSGG+QQR ALARAL+ P +LLLDEP S LD R +++ + +K++ L T Sbjct: 124 LNRHPSTLSGGEQQRTALARALIISPEILLLDEPLSALDPRSKENFQEELKKIHQTLKTT 183 Query: 194 LLVVSHDPADIFAIADRVGVLVKGKLVQVGKPEDLYDNPVSIQVASLIGEINELEGKVTN 253 L V+HD + +AD++GV+ +G+++QVG P++++ P + VAS +G N EG+V + Sbjct: 184 TLHVTHDFNEAMYLADKIGVMHQGQIIQVGTPQEIFYKPQNDFVASFVGIENIFEGQVND 243 Query: 254 EGVVIGSLRFPVSV-----SSDRAIIGIRPEDVKLSKDVIKDDSWILVGKGKVKVIGYQG 308 + V SL V + + + + PED+ LSK+ D + GKV I QG Sbjct: 244 DKV---SLAPDVDIFVNTGKQGKVKVAVPPEDIALSKEPF-DLCYHYQFNGKVLNISNQG 299 Query: 309 GLFRITI 315 L +ITI Sbjct: 300 ALSKITI 306 Lambda K H 0.319 0.139 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 318 Number of extensions: 19 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 353 Length of database: 344 Length adjustment: 29 Effective length of query: 324 Effective length of database: 315 Effective search space: 102060 Effective search space used: 102060 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory