Align TM1749, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized)
to candidate WP_092483976.1 BM299_RS11015 ABC transporter ATP-binding protein
Query= TCDB::Q9X271 (324 letters) >NCBI__GCF_900115975.1:WP_092483976.1 Length = 319 Score = 267 bits (683), Expect = 2e-76 Identities = 137/313 (43%), Positives = 201/313 (64%) Query: 4 LLNVNNLKVEFHRVEGIVKAVDGISYKLNKGESLGIVGESGSGKSVSVLSLLRLINRNGR 63 LL++ L V F +G V +D +S +++GE L IVGESGSGKSV+ LS+L L+++N + Sbjct: 2 LLDIKQLSVSFQTFQGSVHVLDRVSLSVDRGEILAIVGESGSGKSVTALSILGLLDKNAK 61 Query: 64 IVDGEAIFLGKDLLKLNKEELRNIRGKDISIIFQNPMTSLNPIIRVGIQVMEPIIWHRLM 123 I G +F G DL KL+ +E++ RGK I ++FQ PMT+L+P +R+G Q+ I H + Sbjct: 62 IEQGNIVFDGTDLTKLSTKEIQKYRGKRIGMVFQEPMTALHPTMRIGDQLTNVIKRHHKL 121 Query: 124 KNEEARERAIELLERVGIPESPKRFLNYPFQFSGGMRQRVMIAMALACHPKLLIADEPTT 183 +E+ +E+L+ V E YP + SGGMRQR++IA+A++ P+LLIADEPTT Sbjct: 122 TKKESHPIMLEMLKDVHFEEPELIAQKYPHELSGGMRQRIVIALAMSAPPELLIADEPTT 181 Query: 184 ALDVTIQAQIMELLQELKEEYGMSVIFITHDLSVATNFCDRIITMYAGKIVEEAPVEEIL 243 ALDVTIQA+I+ L++EL ++Y ++VI ITHDL V D + MYAGKI+E+ +EIL Sbjct: 182 ALDVTIQAEILTLMKELTQKYNIAVILITHDLGVVREVSDNVCVMYAGKILEKGTTKEIL 241 Query: 244 KTPLHPYTKGLLNSTLEIGSRGKKLVPIPGNPPNPTKHPSGCKFHPRCSFAMEICQREEP 303 P HPYT LL + + + G++L I G P+ +H GC F RC + + C + P Sbjct: 242 DNPKHPYTNLLLRALPDQVNPGERLQEIEGEVPDLKQHLPGCIFSSRCPLSKDECFIKAP 301 Query: 304 PLVNISENHRVAC 316 P +++SE V C Sbjct: 302 PQLSLSETQMVHC 314 Lambda K H 0.320 0.139 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 279 Number of extensions: 14 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 324 Length of database: 319 Length adjustment: 28 Effective length of query: 296 Effective length of database: 291 Effective search space: 86136 Effective search space used: 86136 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory