Align BadK (characterized)
to candidate WP_092482908.1 BM299_RS07795 enoyl-CoA hydratase-related protein
Query= metacyc::MONOMER-943 (258 letters) >NCBI__GCF_900115975.1:WP_092482908.1 Length = 259 Score = 216 bits (549), Expect = 5e-61 Identities = 118/254 (46%), Positives = 158/254 (62%), Gaps = 1/254 (0%) Query: 6 ILTETQGRVGIITLNRPDVLNALNDALMDALGGALLAFDADDGIGAIVIAGNTRAFAAGA 65 ++ E +G V +TLNRP VLNALN + D +G A+ ADDG+ A+VI G + FAAGA Sbjct: 6 LIYEKEGYVSRVTLNRPKVLNALNSEVFDEIGRAMDLAAADDGVHAVVITGGEKVFAAGA 65 Query: 66 DIASMAAWSYSDVYGSNFITRN-WETIRQIRKPVLAAVAGLAYGGGCELALACDIVIAGR 124 DIA MA VY + + + KPV+AA+ G A GGGCELALACDI IAG Sbjct: 66 DIAEMATADPVSVYKFGETAQGALNKVENLPKPVIAAINGYALGGGCELALACDIRIAGE 125 Query: 125 SAKFALPEIKLGLLPGAGGTQRLPRAIGKAKAMDMCLSARPLNAEEADRYGLVSRVVDDD 184 SAK LPEI LG+ PGAGGTQRLPR +G A+A ++ + ++A A++ GLV++VV D Sbjct: 126 SAKIGLPEINLGIFPGAGGTQRLPRLVGAARAKELMFTGDMIDAARAEKIGLVNQVVPDG 185 Query: 185 RLRDETVALATTIAAFSAPALMALKESLNRAFESTLAEGILFERRELHARFASADAREGI 244 + V LA +A A A+ LK ++N+ + LA G+ ER+ FA+ D +EG+ Sbjct: 186 EVLSTAVKLAARMAQKGAVAMAMLKTAINQGLATDLASGLNIERQCFSLLFATEDQKEGM 245 Query: 245 QAFLEKRAPCFSHR 258 QAF+EKR P F R Sbjct: 246 QAFMEKRKPEFKGR 259 Lambda K H 0.321 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 139 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 259 Length adjustment: 24 Effective length of query: 234 Effective length of database: 235 Effective search space: 54990 Effective search space used: 54990 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory