Align Leucine//isoleucine/valine ABC transporter,ATPase component; EC 3.6.3.- (characterized, see rationale)
to candidate WP_092486624.1 BM299_RS15855 urea ABC transporter ATP-binding subunit UrtE
Query= uniprot:G8ALJ1 (236 letters) >NCBI__GCF_900115975.1:WP_092486624.1 Length = 230 Score = 162 bits (411), Expect = 4e-45 Identities = 88/216 (40%), Positives = 130/216 (60%), Gaps = 2/216 (0%) Query: 1 MLKVSGVHTFYGAIEALKGVDIEIGAGEIVSLIGANGAGKSTLLMTICGSPRARMGRITF 60 ML VSG+ +YG LK + + I G++V L+G NG GK+T L +I G + G I Sbjct: 1 MLDVSGLDAYYGDSIILKNISLRIKQGQVVCLLGRNGVGKTTFLKSIMGLVKTPNGSIML 60 Query: 61 EGQDITQMPTYELVRLGIAQSPEGRRIFPRMSVLENLQMGSITAKPGSFANELERVLTLF 120 +G +I +MP+Y GI P+GR IFP +SV ENL +G K S + E + LF Sbjct: 61 DGTEIIKMPSYNRALQGIGYVPQGRDIFPNLSVYENLLLGLERNKNNSTLD--ESIYELF 118 Query: 121 PRLKERISQRAGTMSGGEQQMLAIGRALMSQPRLLLLDEPSLGLAPLVVKQIFQAVKDIN 180 P LK + ++ G +SGG+QQ LAI RAL+S P+LLLLDEP+ G+ P ++++I + +K + Sbjct: 119 PVLKTMLKRKGGDLSGGQQQQLAIARALVSIPKLLLLDEPTEGIQPSIIQEIAKVIKKLK 178 Query: 181 REQKMTVFMVEQNAFHALKLAHRGYVMVNGKVTMSG 216 + +T+ +VEQ L++A YVM G + M G Sbjct: 179 SKGNITMLIVEQYLEFVLEVADYFYVMDKGCIVMEG 214 Lambda K H 0.320 0.136 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 151 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 236 Length of database: 230 Length adjustment: 23 Effective length of query: 213 Effective length of database: 207 Effective search space: 44091 Effective search space used: 44091 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory