Align HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized)
to candidate WP_092482139.1 BM299_RS03860 glycine betaine/L-proline ABC transporter ATP-binding protein
Query= TCDB::Q9KKE1 (275 letters) >NCBI__GCF_900115975.1:WP_092482139.1 Length = 390 Score = 285 bits (730), Expect = 8e-82 Identities = 137/262 (52%), Positives = 194/262 (74%) Query: 4 IEIRNVYKIFGHDAKKALTMVEDGLDKADILSRSGCTVGLNDVSLKIGAGKIFVIMGLSG 63 +E++N+ KIFG + K L V+ G+ K IL +G TVG+ + S ++ G++FVIMGLSG Sbjct: 5 VEVKNLTKIFGRNPKAILEKVKQGMSKEKILEDTGHTVGIRNASFQVEEGEVFVIMGLSG 64 Query: 64 SGKSTLVRHINRLIEPTSGEVLFDGDNILDLGAKALRAFRMRRVSMVFQSFALMPHRTVL 123 SGKSTL+R +N L +PT+GE+ DGDNIL+ K L+ FR +V+MVFQ F L+ HRTV+ Sbjct: 65 SGKSTLIRCLNLLNKPTAGEIYVDGDNILEYDKKQLKKFRQEKVAMVFQHFGLLSHRTVI 124 Query: 124 QNVVYGQRVRGVSKDDAREIGMKWIDTVGLSGYDAKFPHQLSGGMKQRVGLARALAADTD 183 NV YG V+ + K++ EI K I GL+G++ K P++LSGGM+QRVGLARALA D D Sbjct: 125 GNVEYGLEVKKIPKNERCEIAKKAIANAGLAGWENKMPNELSGGMQQRVGLARALANDPD 184 Query: 184 VILMDEAFSALDPLIRGDMQDQLLQLQRNLAKTIVFITHDLDEALRIGSEIAILRDGQVV 243 ++LMDE FSALDPLIR DMQ +L++LQ L KTI+FITHD++EA +IG +A+++DG + Sbjct: 185 ILLMDEPFSALDPLIRRDMQYELMELQSRLKKTIIFITHDINEAFKIGDRVAVMKDGVIE 244 Query: 244 QVGTPNDILDNPANDYVARFVQ 265 Q+GTP ++L +P ++Y+ FV+ Sbjct: 245 QIGTPEELLASPESEYIENFVK 266 Lambda K H 0.323 0.139 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 286 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 275 Length of database: 390 Length adjustment: 28 Effective length of query: 247 Effective length of database: 362 Effective search space: 89414 Effective search space used: 89414 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory