Align HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized)
to candidate WP_092483062.1 BM299_RS08565 glycine betaine/L-proline ABC transporter ATP-binding protein
Query= TCDB::Q9KKE1 (275 letters) >NCBI__GCF_900115975.1:WP_092483062.1 Length = 400 Score = 302 bits (774), Expect = 7e-87 Identities = 147/265 (55%), Positives = 198/265 (74%) Query: 1 MADIEIRNVYKIFGHDAKKALTMVEDGLDKADILSRSGCTVGLNDVSLKIGAGKIFVIMG 60 MA + + N+ KIFG + KAL M+E+G K +IL + CTVG+ ++S ++ G+ FV+MG Sbjct: 1 MAKVIVENLVKIFGDNPGKALKMLEEGKSKQEILEATRCTVGVYNISFEVQEGETFVLMG 60 Query: 61 LSGSGKSTLVRHINRLIEPTSGEVLFDGDNILDLGAKALRAFRMRRVSMVFQSFALMPHR 120 LSGSGKSTL+R +NRLIEPT G++L DG+ I + K LR R ++ MVFQ FAL PHR Sbjct: 61 LSGSGKSTLLRCLNRLIEPTDGKILIDGEEITGVDDKKLRQIRRNKLGMVFQRFALFPHR 120 Query: 121 TVLQNVVYGQRVRGVSKDDAREIGMKWIDTVGLSGYDAKFPHQLSGGMKQRVGLARALAA 180 TV+ NV YG V+G+ K++ E + ++ VGL ++ P QLSGGM+QRVGLARALA+ Sbjct: 121 TVVDNVAYGLEVQGMEKEERLEKARRVLEVVGLKEWENSMPSQLSGGMQQRVGLARALAS 180 Query: 181 DTDVILMDEAFSALDPLIRGDMQDQLLQLQRNLAKTIVFITHDLDEALRIGSEIAILRDG 240 D D++LMDEAFSALDPLIR MQD+LL LQ L KTI+F+THDLDEAL+IG IA+++DG Sbjct: 181 DPDILLMDEAFSALDPLIRKGMQDELLSLQATLNKTIIFVTHDLDEALKIGDRIALMKDG 240 Query: 241 QVVQVGTPNDILDNPANDYVARFVQ 265 ++Q+GT +IL NPAN+YV +FV+ Sbjct: 241 AIIQIGTSEEILTNPANEYVEKFVE 265 Lambda K H 0.323 0.139 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 329 Number of extensions: 11 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 275 Length of database: 400 Length adjustment: 28 Effective length of query: 247 Effective length of database: 372 Effective search space: 91884 Effective search space used: 91884 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory