Align BusAA, component of Uptake system for glycine-betaine (high affinity) and proline (low affinity) (OpuAA-OpuABC) or BusAA-ABC of Lactococcus lactis). BusAA, the ATPase subunit, has a C-terminal tandem cystathionine β-synthase (CBS) domain which is the cytoplasmic K+ sensor for osmotic stress (osmotic strength)while the BusABC subunit has the membrane and receptor domains fused to each other (Biemans-Oldehinkel et al., 2006; Mahmood et al., 2006; Gul et al. 2012). An N-terminal amphipathic α-helix of OpuA is necessary for high activity but is not critical for biogenesis or the ionic regulation of transport (characterized)
to candidate WP_092482139.1 BM299_RS03860 glycine betaine/L-proline ABC transporter ATP-binding protein
Query= TCDB::Q9RQ06 (407 letters) >NCBI__GCF_900115975.1:WP_092482139.1 Length = 390 Score = 403 bits (1036), Expect = e-117 Identities = 199/390 (51%), Positives = 294/390 (75%), Gaps = 2/390 (0%) Query: 1 MPVKVKIEHLTKIFGKRIKTALTMVEQGEPKNEILKKTGATVGVYDTNFEINEGEIFVIM 60 MPVKV++++LTKIFG+ K L V+QG K +IL+ TG TVG+ + +F++ EGE+FVIM Sbjct: 1 MPVKVEVKNLTKIFGRNPKAILEKVKQGMSKEKILEDTGHTVGIRNASFQVEEGEVFVIM 60 Query: 61 GLSGSGKSTLLRLLNRLIEPTSGKIFIDDQDVATLNKEDLLQVRRKSMSMVFQNFGLFPH 120 GLSGSGKSTL+R LN L +PT+G+I++D ++ +K+ L + R++ ++MVFQ+FGL H Sbjct: 61 GLSGSGKSTLIRCLNLLNKPTAGEIYVDGDNILEYDKKQLKKFRQEKVAMVFQHFGLLSH 120 Query: 121 RTILENTEYGLEVQNVPKEERRKRAEKALDNANLLDFKDQYPKQLSGGMQQRVGLARALA 180 RT++ N EYGLEV+ +PK ER + A+KA+ NA L ++++ P +LSGGMQQRVGLARALA Sbjct: 121 RTVIGNVEYGLEVKKIPKNERCEIAKKAIANAGLAGWENKMPNELSGGMQQRVGLARALA 180 Query: 181 NDPEILLMDEAFSALDPLIRREMQDELLELQAKFQKTIIFVSHDLNEALRIGDRIAIMKD 240 NDP+ILLMDE FSALDPLIRR+MQ EL+ELQ++ +KTIIF++HD+NEA +IGDR+A+MKD Sbjct: 181 NDPDILLMDEPFSALDPLIRRDMQYELMELQSRLKKTIIFITHDINEAFKIGDRVAVMKD 240 Query: 241 GKIMQIGTGEEILTNPANDYVKTFVEDVDRAKVITAENIMI-PALTTNIDVDGPSVALKK 299 G I QIGT EE+L +P ++Y++ FV+D+DR+KV+ A+++M P + +I +G A+ + Sbjct: 241 GVIEQIGTPEELLASPESEYIENFVKDIDRSKVLQAKHVMFKPTVLVSIK-EGLKAAMME 299 Query: 300 MKTEEVSSLMAVDRKRQFRGVVTSEQAIAARKNNQSLKDVMTTDVGTVTKEMLVRDILPI 359 MK+ +SS+ VD +++ +G+VT + I A K N++L++++ D T E ++D++P Sbjct: 300 MKSNGISSVFVVDSEKRLQGIVTIDDTIKAIKENKTLREILKHDYYTTDCEAFLQDLIPK 359 Query: 360 IYDAPTPLAVVDDQGYLKGILIRGIVLEAL 389 D PLAV+D+ G L G++ R VL AL Sbjct: 360 ATDTKYPLAVIDEDGKLLGLISRVSVLSAL 389 Lambda K H 0.316 0.135 0.364 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 441 Number of extensions: 12 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 407 Length of database: 390 Length adjustment: 31 Effective length of query: 376 Effective length of database: 359 Effective search space: 134984 Effective search space used: 134984 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory