Align Glycine betaine/proline betaine transport system ATP-binding protein ProV (characterized)
to candidate WP_092484009.1 BM299_RS11075 ABC transporter ATP-binding protein
Query= SwissProt::P17328 (400 letters) >NCBI__GCF_900115975.1:WP_092484009.1 Length = 344 Score = 166 bits (420), Expect = 9e-46 Identities = 85/246 (34%), Positives = 146/246 (59%), Gaps = 12/246 (4%) Query: 35 LEKTGLSLG---VKDASLAIEEGEIFVIMGLSGSGKSTMVRLLNRLIEPTRGQVLIDGVD 91 LE + LG + D +L ++EGE F+I+G +G+GK+ ++ + + P +G + + Sbjct: 4 LEHVTVKLGEFQLLDINLEVQEGEYFIILGPTGTGKTVILETIAGMYRPDKGTIRFKERN 63 Query: 92 IAKISDAELREVRRKKIAMVFQSFALMPHMTVLDNTAFGMELAGIAAQERREKALDALRQ 151 +A ++ + +K+ V+Q +AL PH+TV +N FG ++ + + + K + + Sbjct: 64 LATLAPEQ------RKVGFVYQDYALFPHLTVKENIIFGAQIRKLPKKIIKSKLDELVAM 117 Query: 152 VGLENYAHAYPDELSGGMRQRVGLARALAINPDILLMDEAFSALDPLIRTEMQDELVKLQ 211 +G+ + + +P LSGG +QR LARAL I+P+ILL+DE SALDP + Q+EL K+ Sbjct: 118 LGIGHLLNRHPSTLSGGEQQRTALARALIISPEILLLDEPLSALDPRSKENFQEELKKIH 177 Query: 212 AKHQRTIVFISHDLDEAMRIGDRIAIMQNGEVVQVGTPDEILNNPANDYVRTFFRGVDIS 271 + T + ++HD +EAM + D+I +M G+++QVGTP EI P ND+V +F V I Sbjct: 178 QTLKTTTLHVTHDFNEAMYLADKIGVMHQGQIIQVGTPQEIFYKPQNDFVASF---VGIE 234 Query: 272 QVFSAK 277 +F + Sbjct: 235 NIFEGQ 240 Lambda K H 0.319 0.137 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 313 Number of extensions: 19 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 400 Length of database: 344 Length adjustment: 30 Effective length of query: 370 Effective length of database: 314 Effective search space: 116180 Effective search space used: 116180 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory