Align threonine ammonia-lyase (EC 4.3.1.19) (characterized)
to candidate WP_245779691.1 BM299_RS07595 threonine ammonia-lyase
Query= BRENDA::Q74FW6 (402 letters) >NCBI__GCF_900115975.1:WP_245779691.1 Length = 411 Score = 365 bits (936), Expect = e-105 Identities = 191/393 (48%), Positives = 268/393 (68%) Query: 7 IQEADDRLRKRVRRTELIHSHHFSEKLGIPIYFKCENLQRTGAFKIRGALNFMTSQPREA 66 + +A L V RT + +S FSE G +YFK ENLQ+TG+FKIRGA ++ Sbjct: 17 VDDAASVLAGIVHRTAVDYSSTFSELTGSQVYFKTENLQKTGSFKIRGAYYKISRLTEAQ 76 Query: 67 LAKGVITASAGNHAQGVAFSADLLGVPSTVFMPESTPPQKVFATRDYGAEVVLTGRNFDE 126 A+GVITASAGNHAQGVA++A G+ +TV MP + P KV ATR YGAEVVL GR +DE Sbjct: 77 RARGVITASAGNHAQGVAYAAARAGIGATVVMPLTAPIAKVEATRGYGAEVVLAGRGYDE 136 Query: 127 AYAAAVQAQEERGALFVHPFDDPLVMAGQGTIGLEVLQELPDVANILVPIGGGGLIAGIA 186 A+A A + Q + GA F+H FDDP ++AGQGT+GLE+L++LP +++P+GGGGL+AG A Sbjct: 137 AFAEARELQAKTGATFIHGFDDPDIIAGQGTVGLEILEQLPHADAVILPVGGGGLVAGTA 196 Query: 187 TAIRETHPHVRIIGVETAAAPSAHYSLQKGKIVQVPVTVTLADGIAVKKPGVNTFPIIRD 246 A++ P V++IGV++ AP+ S Q + + TLADGIAV++PG TF ++ Sbjct: 197 LAVKSRRPAVKVIGVQSEGAPAMCLSHQARCLQESGSACTLADGIAVRRPGRLTFELVCR 256 Query: 247 LVDEVVLVEEEEIALAIVALLERTKLLVEGAGAVPLAALLNRRVTDLSGKTVCVLSGGNI 306 VD+VV V +EEIA AI LLER+KL+VEGAGA LAAL+ +RV V VLSGGNI Sbjct: 257 YVDDVVTVSDEEIARAITMLLERSKLVVEGAGAAGLAALMQKRVVLPGATVVVVLSGGNI 316 Query: 307 DVKTISVVVERGLVAAGRYLKLKVELDDLPGALARLATEIAEAKANISIITHDRRSKSLP 366 D+ T+S+++ERGL+ +GR + ++ +DD PG L +L IA+ +ANI + HDR +P Sbjct: 317 DINTVSILIERGLLQSGRRVYIRAMVDDRPGMLQKLLGAIADMQANIITVAHDRVDPRVP 376 Query: 367 IGKTEVLIELETRGFEHIQEVISHLQGVGYLVD 399 + K EV + LETR H++++I+ L+ +G+ V+ Sbjct: 377 LKKAEVKLLLETRSRSHVRDIINRLREIGWEVE 409 Lambda K H 0.319 0.137 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 391 Number of extensions: 12 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 402 Length of database: 411 Length adjustment: 31 Effective length of query: 371 Effective length of database: 380 Effective search space: 140980 Effective search space used: 140980 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory