Align ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component (characterized)
to candidate WP_092484009.1 BM299_RS11075 ABC transporter ATP-binding protein
Query= reanno::WCS417:GFF2490 (367 letters) >NCBI__GCF_900115975.1:WP_092484009.1 Length = 344 Score = 192 bits (489), Expect = 9e-54 Identities = 91/214 (42%), Positives = 146/214 (68%) Query: 22 IDLEVNDKEFVVFVGPSGCGKSTLLRLIAGLEEVSEGTIELDGRDITEVTPAKRDLAMVF 81 I+LEV + E+ + +GP+G GK+ +L IAG+ +GTI R++ + P +R + V+ Sbjct: 19 INLEVQEGEYFIILGPTGTGKTVILETIAGMYRPDKGTIRFKERNLATLAPEQRKVGFVY 78 Query: 82 QTYALYPHMSVRKNMSFALDLAGVDKKLVESKVSEAARILELGPLLERKPKQLSGGQRQR 141 Q YAL+PH++V++N+ F + + KK+++SK+ E +L +G LL R P LSGG++QR Sbjct: 79 QDYALFPHLTVKENIIFGAQIRKLPKKIIKSKLDELVAMLGIGHLLNRHPSTLSGGEQQR 138 Query: 142 VAIGRAIVRNPKIFLFDEPLSNLDAALRVQMRLELARLHKELQATMIYVTHDQVEAMTLA 201 A+ RA++ +P+I L DEPLS LD + + EL ++H+ L+ T ++VTHD EAM LA Sbjct: 139 TALARALIISPEILLLDEPLSALDPRSKENFQEELKKIHQTLKTTTLHVTHDFNEAMYLA 198 Query: 202 DKVVVLNSGRIEQVGSPLELYHQPANLFVAGFLG 235 DK+ V++ G+I QVG+P E++++P N FVA F+G Sbjct: 199 DKIGVMHQGQIIQVGTPQEIFYKPQNDFVASFVG 232 Lambda K H 0.319 0.136 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 281 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 367 Length of database: 344 Length adjustment: 29 Effective length of query: 338 Effective length of database: 315 Effective search space: 106470 Effective search space used: 106470 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory