Align Glucosamine-6-phosphate deaminase [isomerizing], alternative (EC 3.5.99.6) (characterized)
to candidate WP_245795223.1 BUB04_RS16750 glutamine--fructose-6-phosphate transaminase (isomerizing)
Query= reanno::Caulo:CCNA_00453 (363 letters) >NCBI__GCF_900129305.1:WP_245795223.1 Length = 615 Score = 142 bits (357), Expect = 3e-38 Identities = 110/317 (34%), Positives = 156/317 (49%), Gaps = 28/317 (8%) Query: 64 RVVVTCARGSSDHAATFARYLIETKAGVLTSSAGPSVSSVYDASPNL--EGALYLAISQS 121 R V A G+S HA +YL+E G+ ++S + L + +L + +SQS Sbjct: 300 RKVFLVACGTSYHACLVGKYLLE---GLCRIPVEVDLASEFRYRKPLLDDQSLLIVVSQS 356 Query: 122 GKSPDLLAAVKAAKAAGAHAVALVNVVDSPLAALADEVIPLHAGPELSVAATKSYIAALV 181 G++ D AA+K GAH A+VNVV S LA +A V+ HAGPE+ VA+TK++ +V Sbjct: 357 GETADTRAALKEGLERGAHCRAIVNVVGSSLARMAHGVLYTHAGPEIGVASTKAFTTQVV 416 Query: 182 AVTQLIAAWTEDA-------------ELTAALQDLPTALAAAWTL-DWSLAVERLKTASN 227 A L W + EL A + L L A L DW A E LK Sbjct: 417 AFYLLALHWARTSGTISDPEFSEHLRELLALPRKLEEVLDRADVLRDW--AREFLKVEHF 474 Query: 228 LYVLGRGVGFGVALEAALKFKETCGLHAEAFSAAEVLHGPMALVKDGFPALVFAQNDESR 287 LY LGRG+ + +ALE ALK KE +HAE ++A E+ HGP+AL+ + P +V AQ E Sbjct: 475 LY-LGRGILYPIALEGALKLKEISYIHAEGYAAGEMKHGPIALIDENMPVVVLAQKGELY 533 Query: 288 ASVDEMAAGLRARGASVLIAGGG------GDAPDALPTLASHPVLEPILMIQSFYRMANA 341 + +RARG VL G G++ P + P L P++ +A Sbjct: 534 EKMLSNVQEVRARGGRVLAIVEGEQDPRLGESTWQFPVPETSPWLAPVVFSIPLQLLAYH 593 Query: 342 LSVARGYDPDSPPHLNK 358 ++ RG D D P +L K Sbjct: 594 VADLRGTDVDQPRNLAK 610 Lambda K H 0.315 0.128 0.360 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 400 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 363 Length of database: 615 Length adjustment: 33 Effective length of query: 330 Effective length of database: 582 Effective search space: 192060 Effective search space used: 192060 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory