Align Extracellular solute-binding protein, family 3 (characterized, see rationale)
to candidate WP_073038909.1 BUB04_RS09970 transporter substrate-binding domain-containing protein
Query= uniprot:E4PNW5 (250 letters) >NCBI__GCF_900129305.1:WP_073038909.1 Length = 273 Score = 103 bits (258), Expect = 3e-27 Identities = 71/229 (31%), Positives = 108/229 (47%), Gaps = 13/229 (5%) Query: 22 QERDLRIAFDVPYEPFEYKDENGELTGFEVELAEAMCEEMNANCEFVIQAWDGMIPGLLA 81 Q L + +V Y PFEY DE G+ GF+V++A M +E+ E W G+IP L + Sbjct: 44 QRNKLIVGMEVEYFPFEYADEKGQPMGFDVDIARLMAQELGVELEIKDIEWTGLIPSLQS 103 Query: 82 RKFDLIMSSMSITPERAERVLFSEPYYNTPGGWFGPESFNTDVTDMSAME--GKTVGVQR 139 K DL++S M+ T RA V F++PY+ T + VT + + G+ + V+ Sbjct: 104 GKVDLVISGMTRTLARARAVSFTDPYFVTGLCALLSAKKASGVTHVDQLNAPGRVLAVKT 163 Query: 140 GTTMDTYVTENMGGIVTIKRYTTADDMVLDLEGQRLDVVFVDYPVGEQTVLTKEGFKEVG 199 GTT D ++ TI R+ V ++ R D F D Q + K + Sbjct: 164 GTTGDLVASKRFPK-ATINRFKDETACVREVVTGRADAFFYD-----QISIAKHHKQNPD 217 Query: 200 EAVKL-----GEGVGVAMRQRDTDLAEEVNAALRTLKEDGTYDTIMQKY 243 + L E +A+R+ D D + +N L T+K DG YD I QK+ Sbjct: 218 STIALLEPFTYEPFAIAIRKGDADFLQWLNLFLETIKADGRYDEIFQKH 266 Lambda K H 0.318 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 165 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 250 Length of database: 273 Length adjustment: 25 Effective length of query: 225 Effective length of database: 248 Effective search space: 55800 Effective search space used: 55800 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory