Align Arginine transport ATP-binding protein ArtM (characterized)
to candidate WP_337833398.1 BUB04_RS10875 amino acid ABC transporter ATP-binding protein
Query= SwissProt::P54537 (240 letters) >NCBI__GCF_900129305.1:WP_337833398.1 Length = 257 Score = 265 bits (677), Expect = 6e-76 Identities = 138/247 (55%), Positives = 176/247 (71%), Gaps = 7/247 (2%) Query: 1 MIKVEKLSKSFGKH-EVLKNISTTIAEGEVVAVIGPSGSGKSTFLRCLNLLEKPNGGTIT 59 M++V L K FG+ VL+ I + +GEVV ++GPSGSGKST LRC+N LE+P GTI Sbjct: 7 MVEVSNLHKVFGEDLHVLRGIDLEVKKGEVVVILGPSGSGKSTLLRCINFLEEPTAGTIR 66 Query: 60 IKDTEITKPK------TNTLKVRENIGMVFQHFHLFPHKTVLENIMYAPVNVKKESKQAA 113 + D I K L++R +GM FQ F+LFPH T LENI+ PV V +SK+ A Sbjct: 67 VGDITIGAGKKTKEHNAKILEIRRRVGMCFQSFNLFPHMTALENIIEGPVTVLGQSKKEA 126 Query: 114 QEKAEDLLRKVGLFEKRNDYPNRLSGGQKQRVAIARALAMNPDIMLFDEPTSALDPEMVK 173 AE+LL VGL +KR++YP+RLSGGQ+QRVAIAR+LAM PD+MLFDEPTSALDPE+VK Sbjct: 127 IPYAEELLAWVGLTDKRDEYPSRLSGGQQQRVAIARSLAMKPDVMLFDEPTSALDPELVK 186 Query: 174 EVLQVMKELVETGMTMVIVTHEMGFAKEVADRVLFMDQGMIVEDGNPKEFFMSPKSKRAQ 233 EV+ VM+ L GMT++ VTHEM FA++VADRVL MD G+ VE G P+E F +PK R++ Sbjct: 187 EVVDVMERLAAEGMTIIAVTHEMHFARDVADRVLIMDGGVWVESGPPEEIFTNPKEARSR 246 Query: 234 DFLEKIL 240 FL IL Sbjct: 247 QFLAHIL 253 Lambda K H 0.317 0.134 0.368 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 188 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 240 Length of database: 257 Length adjustment: 24 Effective length of query: 216 Effective length of database: 233 Effective search space: 50328 Effective search space used: 50328 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory