Align ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate WP_143156507.1 BUB04_RS14480 ABC transporter ATP-binding protein
Query= uniprot:Q1MCU2 (292 letters) >NCBI__GCF_900129305.1:WP_143156507.1 Length = 275 Score = 211 bits (538), Expect = 1e-59 Identities = 120/264 (45%), Positives = 168/264 (63%), Gaps = 10/264 (3%) Query: 10 SDDTLLKVEHLSMKFGGLMAINDFSFEAKRGDITALIGPNGAGKTTVFNCITGFYKPTMG 69 S D +L ++ + M+FGG+ A+ ++ RG + ++IGPNGAGKTT+ NCI+G PT G Sbjct: 8 SSDPILILQDVHMQFGGVTALKGIRYQVPRGIVQSIIGPNGAGKTTLLNCISGVLHPTEG 67 Query: 70 MITFNQKSGKQYLLERLPDFRITKEARVARTFQNIRLFSGLTVLENLLVAQHNKLMKASG 129 I+F + +ER P RI ++RTFQ++ LF ++VLEN++V +H + SG Sbjct: 68 RISFLGRR-----VEREPPHRIAALG-MSRTFQHVALFPQMSVLENVMVGRH--VRTRSG 119 Query: 130 YTILGLIGVGPYKREAAEAIELARFWLEKADLIDRADDPAGDLPYGAQRRLEIARAMCTG 189 + GL + EAA + AR WL+ L D A PAG LP G Q+ LEIARA+ T Sbjct: 120 FWAAGLRTRSMRREEAAIGRD-ARAWLDFVGLADAAHLPAGALPLGKQKILEIARALATD 178 Query: 190 PELLCLDEPAAGLNPRESATLNALLKSIRAETGTSILLIEHDMSVVMEISDHVVVLEYGQ 249 P LL LDEPA GLN RE+ L L+ I+ E GT+++L+EHDM++VM ISD ++VL YGQ Sbjct: 179 PALLLLDEPAGGLNTRETEELGELIGRIK-ERGTTVILVEHDMNLVMTISDRILVLYYGQ 237 Query: 250 KISDGTPDHVKNDPRVIAAYLGVE 273 ++ G PD +K +P VI AYLG E Sbjct: 238 PLASGVPDEIKENPEVIQAYLGDE 261 Lambda K H 0.318 0.136 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 212 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 275 Length adjustment: 26 Effective length of query: 266 Effective length of database: 249 Effective search space: 66234 Effective search space used: 66234 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory