Align PEB1C, component of Uptake system for glutamate and aspartate (characterized)
to candidate WP_073040497.1 BUB04_RS13800 amino acid ABC transporter ATP-binding protein
Query= TCDB::A3ZI83 (242 letters) >NCBI__GCF_900129305.1:WP_073040497.1 Length = 243 Score = 255 bits (652), Expect = 5e-73 Identities = 136/244 (55%), Positives = 176/244 (72%), Gaps = 5/244 (2%) Query: 1 MIELKNVNK-YYGTHHV--LKNINLSVKEGEKLVIIGPSGSGKSTTIRCMNGLEEVSSGE 57 MI+++NV+K +Y H V L+N++ V +GE +VIIGPSGSGKST +RC+N LE SG Sbjct: 1 MIKVENVSKTFYAPHEVRALQNVSCQVDKGEVVVIIGPSGSGKSTLLRCLNRLEHADSGH 60 Query: 58 VVVNNL-VLNHKNKIEICRKYCAMVFQHFNLYPHMTVLQNLTLAPMKLQKKSKKEAEETA 116 + ++ + +L+ K I R MVFQ FNL+PH TVL+N+TLA ++K+ +KEAE+ A Sbjct: 61 IYIDGIDILDRKTNINKVRAEVGMVFQSFNLFPHKTVLENVTLAQQVVRKRDRKEAEKKA 120 Query: 117 FKYLKVVGLLDKANVYPATLSGGQQQRVAIARSLCTKKPYILFDEPTSALDPETIQEVLD 176 L+ VG+ DKA VYP LSGGQQQRVAIAR+L +LFDEPTSALDPE I EVLD Sbjct: 121 MTLLEKVGIPDKAGVYPDQLSGGQQQRVAIARALAMDPKVMLFDEPTSALDPEMIGEVLD 180 Query: 177 VMKEISHQSNTTMVVVTHEMGFAKEVADRIIFMEDGAIVEENIPSEFFSNPKTERARLFL 236 VMK ++ + TMVVVTHEMGFA+EVADR+IFM++G IVE P FF NP +R +LFL Sbjct: 181 VMKTLA-KEGMTMVVVTHEMGFAREVADRVIFMDEGTIVEVGTPEHFFRNPTHKRTKLFL 239 Query: 237 GKIL 240 +IL Sbjct: 240 SQIL 243 Lambda K H 0.317 0.133 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 187 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 242 Length of database: 243 Length adjustment: 23 Effective length of query: 219 Effective length of database: 220 Effective search space: 48180 Effective search space used: 48180 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory