Align ATP-binding cassette domain-containing protein; SubName: Full=Amino acid transporter; SubName: Full=Histidine ABC transporter ATP-binding protein; SubName: Full=Histidine transport system ATP-binding protein (characterized, see rationale)
to candidate WP_073037863.1 BUB04_RS05930 amino acid ABC transporter ATP-binding protein
Query= uniprot:A0A1N7U8S3 (276 letters) >NCBI__GCF_900129305.1:WP_073037863.1 Length = 256 Score = 222 bits (566), Expect = 6e-63 Identities = 120/252 (47%), Positives = 169/252 (67%), Gaps = 12/252 (4%) Query: 25 IKLQVEGIHKRYGEHEVLKGVSLNARQGDVISLIGASGSGKSTMLRCINFLEQPDAGVIT 84 + +++ +HK +GE VLKG++L + + I + G SGSGKST++RCIN LE+ G I Sbjct: 15 VMVEIIDLHKWFGEFHVLKGINLKVNKQERIVICGPSGSGKSTLIRCINRLEEHQRGRII 74 Query: 85 LDGISIEMRQGRAGTRAPHQDQLQNLRTRLAMVFQHFNLWSHMTVLENITMAPRRVLDVS 144 +DGI + + ++ +R+ + MVFQHFNL+ H+TVL+N+T+ P V V Sbjct: 75 VDGIEL----------TNNIKNIEKIRSEVGMVFQHFNLFPHLTVLDNLTLGPIWVRKVP 124 Query: 145 AAEAEKRARMYLDKVGLPSRVADQYPAFLSGGQQQRVAIARALAMEPEIILFDEPTSALD 204 EAE+ A YL+KV + + A +YP LSGGQQQRVAIAR+L M P+++LFDEPTSALD Sbjct: 125 RKEAEETAMYYLEKVHIAEQ-AHKYPGQLSGGQQQRVAIARSLCMSPKVMLFDEPTSALD 183 Query: 205 PELVGEVLKVIQTLAEEGRTMLMVTHEMGFARQVSSQVLFLHQGR-VEEHGDARILDQPN 263 PE++ EVL V+ LA+EG TM++VTHEMGFAR V+ +VLF+ G+ VEE+ + P Sbjct: 184 PEMIKEVLDVMIELAQEGMTMIVVTHEMGFARSVAHRVLFMDGGQVVEENTPEEFFNNPQ 243 Query: 264 SERLQQFLSNRL 275 ER + FLS L Sbjct: 244 HERTKLFLSQIL 255 Lambda K H 0.319 0.133 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 202 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 256 Length adjustment: 25 Effective length of query: 251 Effective length of database: 231 Effective search space: 57981 Effective search space used: 57981 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory