Align UDP-glucose 4-epimerase (EC 5.1.3.2) (characterized)
to candidate WP_218588471.1 BUB04_RS13705 NAD-dependent epimerase/dehydratase family protein
Query= BRENDA::P9WN67 (314 letters) >NCBI__GCF_900129305.1:WP_218588471.1 Length = 322 Score = 177 bits (449), Expect = 3e-49 Identities = 113/318 (35%), Positives = 161/318 (50%), Gaps = 16/318 (5%) Query: 4 LVTGAAGFIGSTLVDRLLADGHSVVGLDNFATGRATNLEHLADNSAHVFVEADIVTADLH 63 +VTGAAGF+GS L RLL G V+G+DNF +G N++ D+ F E + +L Sbjct: 1 MVTGAAGFVGSHLCRRLLDLGCRVIGVDNFFSGHRDNMQEFQDHPRFFFHERSVTERNLL 60 Query: 64 AIL--EQHRPEVVFHLAAQIDVRRSVADPQFDAAVNVIGTVRLAEAARQTGVRKIVHTSS 121 + L + P V+FHLAA + V SV PQ VN + TVRL E AR G + V S Sbjct: 61 SDLAVDYGPPSVIFHLAAIVSVPYSVEHPQETREVNYLATVRLLEEARNLGCSRFVFAGS 120 Query: 122 GGSIYGTPPEYPTPET---APTDPASPYAAGKVAGEIYLNTFRHLYGLDCSHIAPANVYG 178 YG P E T SPY K + YG + N+YG Sbjct: 121 AAE-YGNDMRLPLKEAYAGGETSWLSPYGEAKYRSSKAVGACG--YGPRGVALRCFNIYG 177 Query: 179 PRQDPHGE-AGVVAIFAQALLSGKPTRVFGDGTNTRDYVFVDDVVDAFVRVSA------D 231 PRQDP +GV++ FA+ + G+P +FGDG TRD+V+V DVV+A+ R + Sbjct: 178 PRQDPSSPYSGVISRFAELAVQGEPLTIFGDGRQTRDFVYVSDVVEAYCRAAGLDPSAPK 237 Query: 232 VGGGLRFNIGTGKETSDRQLHSAVAAAVGGPDDPEFHPPRLGDLKRSCLDIGLAERVLGW 291 V G+ +N+G+G TS +L + + F+P R GD++ S I + + W Sbjct: 238 VPAGI-YNVGSGTRTSVLELARLILNLTERGESIRFYPERPGDIRHSVASIDAIQAAMAW 296 Query: 292 RPQIELADGVRRTVEYFR 309 RP I L +G+RRT+ + + Sbjct: 297 RPHISLEEGLRRTLRWMQ 314 Lambda K H 0.320 0.137 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 261 Number of extensions: 15 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 314 Length of database: 322 Length adjustment: 27 Effective length of query: 287 Effective length of database: 295 Effective search space: 84665 Effective search space used: 84665 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory