Align ABC transporter for D-glucosamine, ATPase component (characterized)
to candidate WP_073037863.1 BUB04_RS05930 amino acid ABC transporter ATP-binding protein
Query= reanno::pseudo3_N2E3:AO353_21725 (265 letters) >NCBI__GCF_900129305.1:WP_073037863.1 Length = 256 Score = 238 bits (607), Expect = 9e-68 Identities = 122/249 (48%), Positives = 173/249 (69%), Gaps = 10/249 (4%) Query: 12 SQALLEIRDLHKQYGPLEVLKGVDLTMQRGNVVTLIGSSGSGKTTLLRCVNMLEEFQGGQ 71 S+ ++EI DLHK +G VLKG++L + + + + G SGSGK+TL+RC+N LEE Q G+ Sbjct: 13 SEVMVEIIDLHKWFGEFHVLKGINLKVNKQERIVICGPSGSGKSTLIRCINRLEEHQRGR 72 Query: 72 ILLDGESIGYHEVNGKRVRHSEKVIAQHRAMTGMAFQQFNLFPHLTALQNVTLGLLKVKK 131 I++DG + +++ EK+ R+ GM FQ FNLFPHLT L N+TLG + V+K Sbjct: 73 IIVDGIELT------NNIKNIEKI----RSEVGMVFQHFNLFPHLTVLDNLTLGPIWVRK 122 Query: 132 LHKDEAVVLAEKWLERVGLLERRDHYPGQLSGGQQQRVAIARAIAMNPSLMLFDEVTSAL 191 + + EA A +LE+V + E+ YPGQLSGGQQQRVAIAR++ M+P +MLFDE TSAL Sbjct: 123 VPRKEAEETAMYYLEKVHIAEQAHKYPGQLSGGQQQRVAIARSLCMSPKVMLFDEPTSAL 182 Query: 192 DPELVGEVLSVIKGLAEDGMTMLLVTHEMRFAFEVSDKIVFMNQGRIEEQGPPKELFERP 251 DPE++ EVL V+ LA++GMTM++VTHEM FA V+ +++FM+ G++ E+ P+E F P Sbjct: 183 DPEMIKEVLDVMIELAQEGMTMIVVTHEMGFARSVAHRVLFMDGGQVVEENTPEEFFNNP 242 Query: 252 QSPRLAEFL 260 Q R FL Sbjct: 243 QHERTKLFL 251 Lambda K H 0.319 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 199 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 265 Length of database: 256 Length adjustment: 24 Effective length of query: 241 Effective length of database: 232 Effective search space: 55912 Effective search space used: 55912 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory