Align 2-dehydro-3-deoxygluconokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; EC 2.7.1.45 (characterized)
to candidate WP_073037865.1 BUB04_RS05935 PfkB family carbohydrate kinase
Query= SwissProt::Q53W83 (309 letters) >NCBI__GCF_900129305.1:WP_073037865.1 Length = 243 Score = 50.1 bits (118), Expect = 5e-11 Identities = 64/211 (30%), Positives = 84/211 (39%), Gaps = 21/211 (9%) Query: 26 RLLEVYVGGAEVNVAVALARLGVKVGFVGRVGEDELGAMVEERLRAEGVDLTHFRRAPGF 85 R L + GG VALAR G++ G VG D G + LR EGVD H G Sbjct: 35 RDLTIQGGGPTATALVALARWGLRTALCGVVGGDAFGEEILASLRREGVDTRHVLVRKGK 94 Query: 86 TGLYLREYLPLGQGRVFYYRKGSAGSALAPGAFDPDYLEGVRFLHLSGITPALSPEARAF 145 T + G GR + + G AL D + R L +T L +A Sbjct: 95 TSQFAFIVAEAGTGRRTIFWQRPTGEALRSFEVPLDEVRAARAL----LTDGLFMDA--- 147 Query: 146 SLWAMEEAKRRGVRVSLDVNYRQTLWSPEEARGFLERALPGVDLLFLSEEEAELLFG--R 203 +L A E A+R V V +D + G L+ A D SE A L G Sbjct: 148 ALRAAEAARRASVPVVVDAGSLRD--------GMLDLARKS-DHFITSETFARSLVGGSD 198 Query: 204 VEEALRALS--APEVV-LKRGAKGAWAFVDG 231 E A R L+ P+VV + G +G+ DG Sbjct: 199 PEGACRKLAELGPKVVGVTLGPRGSVFHADG 229 Lambda K H 0.320 0.139 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 158 Number of extensions: 6 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 309 Length of database: 243 Length adjustment: 25 Effective length of query: 284 Effective length of database: 218 Effective search space: 61912 Effective search space used: 61912 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory