Align 2-ketogluconate 6-phosphate reductase (EC 1.1.1.43) (characterized)
to candidate WP_073040765.1 BUB04_RS14555 phosphoglycerate dehydrogenase
Query= reanno::BFirm:BPHYT_RS11290 (321 letters) >NCBI__GCF_900129305.1:WP_073040765.1 Length = 526 Score = 182 bits (462), Expect = 2e-50 Identities = 111/303 (36%), Positives = 163/303 (53%), Gaps = 14/303 (4%) Query: 13 DVLAYLQQHAQVVQVDATQHDAFVAALKDADGGIGSSVKITPAMLEGATRLKALSTISVG 72 +VLA Q + V+ A DA V + S K+T ++ A RLK + G Sbjct: 24 EVLAPDQPGPEEVRELAADCDALV---------VRSRTKVTEDLISAAPRLKVIGRAGTG 74 Query: 73 FDQFDVADLTRRGIVLANTPDVLTESTADTVFSLILASARRVVELAEWVKAGHWQHSIGP 132 D D+A + RGI++ NTP + A+ +L+LA AR V + + ++ G W+ Sbjct: 75 VDNIDIAAASARGILVMNTPGANAMAAAEHTMALMLALARHVPQATQSLRDGRWEKK--- 131 Query: 133 ALFGVDVQGKTLGIVGLGRIGGAVARRAALGFNMKVLYTNRSANPQAEEAYGARRVELAE 192 G ++ +TLGI+GLG+IG VA RA LG M VL + P+ G V L E Sbjct: 132 RFMGTELYQQTLGIIGLGKIGAIVADRA-LGMKMNVLVYDPHITPETAAIMGTEWVPLEE 190 Query: 193 LLATADFVCLQVPLTPETKHLIGAAELKSMKKSAILINASRGATVDEKALIEALQNGTIH 252 L +DF+ L PLTP+T+++I + MKK +IN +RG VDE+AL EAL +G + Sbjct: 191 LFQRSDFITLHTPLTPDTRNIINRDSIALMKKGVRIINCARGGLVDEEALYEALVSGHVA 250 Query: 253 GAGLDVFETEPLPSDSPLLKLANVVALPHIGSATHETRHAMARNAAENLVAALDGTLTSN 312 GA LDVF EP P +PLL+L NV+ PH+G+++ + + +AR A +V L + N Sbjct: 251 GAALDVFAKEP-PEGNPLLRLENVIFTPHLGASSFQAQENVARAIASQIVDYLKRGIIRN 309 Query: 313 IVN 315 VN Sbjct: 310 AVN 312 Lambda K H 0.317 0.131 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 331 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 321 Length of database: 526 Length adjustment: 31 Effective length of query: 290 Effective length of database: 495 Effective search space: 143550 Effective search space used: 143550 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory