Align ABC transporter for L-Histidine, ATPase component (characterized)
to candidate WP_073036172.1 BUB04_RS01200 ABC transporter ATP-binding protein
Query= reanno::acidovorax_3H11:Ac3H11_2560 (259 letters) >NCBI__GCF_900129305.1:WP_073036172.1 Length = 282 Score = 298 bits (762), Expect = 1e-85 Identities = 148/251 (58%), Positives = 190/251 (75%) Query: 6 IQAVSRVFETAKGQRTQALQPVDFEVRDNDFVTILGPSGCGKSTLLRIVAGLDHATSGRV 65 I+ VS+VF T G +AL V+ V + +FVTI+G SGCGKSTLLRIVAGLD + GR+ Sbjct: 8 IENVSKVFHTPGGHPIEALTDVNAYVEEGEFVTIVGTSGCGKSTLLRIVAGLDAPSGGRI 67 Query: 66 LLDGAPVEGPGAERGMVFQSYTLFPWLTIEQNIRFGLRERGMPEAQQKERAAYFIAKVGL 125 LLDG V GPGA+RGMVFQSYTL+ WLT+ NI FG+R RG ++ ++ + I KVGL Sbjct: 68 LLDGREVGGPGADRGMVFQSYTLYEWLTVYDNIAFGMRLRGASPSEIHDKVRFLIDKVGL 127 Query: 126 RGFEQHFPKQLSGGMQQRTAIARALANDPKILLMDEPFGALDNQTRVLMQELLLGIWEAE 185 GF+ +P+ LSGGM+QR AIARA+ANDPKILL+DEPFGALD QTR +MQELLL + E + Sbjct: 128 AGFDDVYPRFLSGGMKQRVAIARAMANDPKILLLDEPFGALDAQTRTIMQELLLQVAEEQ 187 Query: 186 RKTVLFVTHDIDEAIFMANRVAVFSARPGRIKTELAVDLPHPRHYTIKTSPEFMDLKARL 245 + TVLFVTHDIDEAIF+ + V V S RPG IK E+ +D+PHPR + ++TSP F ++K R+ Sbjct: 188 KITVLFVTHDIDEAIFLGDAVYVMSFRPGTIKEEVKIDVPHPRDHEVRTSPFFTEIKRRI 247 Query: 246 TEEIRAESMAA 256 T+ IR E++ A Sbjct: 248 TQSIREETLKA 258 Lambda K H 0.322 0.136 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 244 Number of extensions: 3 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 282 Length adjustment: 25 Effective length of query: 234 Effective length of database: 257 Effective search space: 60138 Effective search space used: 60138 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory