Align BgtA aka SLR1735, component of Arginine/lysine/histidine/glutamine porter (characterized)
to candidate WP_073040497.1 BUB04_RS13800 amino acid ABC transporter ATP-binding protein
Query= TCDB::P73721 (252 letters) >NCBI__GCF_900129305.1:WP_073040497.1 Length = 243 Score = 252 bits (644), Expect = 4e-72 Identities = 133/246 (54%), Positives = 177/246 (71%), Gaps = 8/246 (3%) Query: 8 LISFDQLQKNFGA---LQVLRGVTGEIYPKDVISIIGPSGCGKSTFLRCLNRLEPISGGR 64 +I + + K F A ++ L+ V+ ++ +V+ IIGPSG GKST LRCLNRLE G Sbjct: 1 MIKVENVSKTFYAPHEVRALQNVSCQVDKGEVVVIIGPSGSGKSTLLRCLNRLEHADSGH 60 Query: 65 LEVAGVDLSGAKIDQK-HLRQLRVRVGMVFQHFNLFPHLTVLQNLLLAPRKVLRIPMAEA 123 + + G+D+ +D+K ++ ++R VGMVFQ FNLFPH TVL+N+ LA + V + EA Sbjct: 61 IYIDGIDI----LDRKTNINKVRAEVGMVFQSFNLFPHKTVLENVTLAQQVVRKRDRKEA 116 Query: 124 KDRALTYLDKVGLGTKADNYPDQLSGGQKQRVAIARGLCMKPEILLFDEPTSALDPELVG 183 + +A+T L+KVG+ KA YPDQLSGGQ+QRVAIAR L M P+++LFDEPTSALDPE++G Sbjct: 117 EKKAMTLLEKVGIPDKAGVYPDQLSGGQQQRVAIARALAMDPKVMLFDEPTSALDPEMIG 176 Query: 184 EVLNVMKQLAEEGMTMAVVTHEMQFAREVSNRVFFFNQGIIEEEGDPNEVFRNPKSDRLR 243 EVL+VMK LA+EGMTM VVTHEM FAREV++RV F ++G I E G P FRNP R + Sbjct: 177 EVLDVMKTLAKEGMTMVVVTHEMGFAREVADRVIFMDEGTIVEVGTPEHFFRNPTHKRTK 236 Query: 244 AFLSRI 249 FLS+I Sbjct: 237 LFLSQI 242 Lambda K H 0.321 0.139 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 196 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 252 Length of database: 243 Length adjustment: 24 Effective length of query: 228 Effective length of database: 219 Effective search space: 49932 Effective search space used: 49932 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory