Align ABC transporter for L-Histidine, ATPase component (characterized)
to candidate WP_073040418.1 BUB04_RS13540 glycine betaine/L-proline ABC transporter ATP-binding protein
Query= reanno::pseudo5_N2C3_1:AO356_09610 (276 letters) >NCBI__GCF_900129305.1:WP_073040418.1 Length = 401 Score = 280 bits (717), Expect = 3e-80 Identities = 142/263 (53%), Positives = 196/263 (74%), Gaps = 1/263 (0%) Query: 8 KIEVKNVFKIFGNRSKEALELIRQN-KTKDQVLAETGCVVGVNDLSLSIGTGEIFVIMGL 66 KI+V+N++KIFGN S EA E + + + + L+ GC V V + + GEIFVIMGL Sbjct: 7 KIQVRNLWKIFGNLSGEAAERLASDPEAALEDLSLNGCTVAVRAVDFHVNEGEIFVIMGL 66 Query: 67 SGSGKSTLVRHFNRLIDPTSGAILVDGEDILQLDMDALREFRRHKISMVFQSFGLLPHKS 126 SGSGKSTL+R N +I+PT G +L+DGE + + LR R+ K++MVFQ F LLP++S Sbjct: 67 SGSGKSTLLRCLNGIIEPTCGEVLIDGEGVGAMTPKRLRALRQQKMAMVFQHFALLPYRS 126 Query: 127 VLDNVAYGLKVRGESKQVCAERALHWINTVGLKGYENKYPHQLSGGMRQRVGLARALAAD 186 VLDNVA+GL+++G K+ RA ++ VGL +E P +LSGGM+QRVGLARALA D Sbjct: 127 VLDNVAFGLELQGVGKKERRRRAREVLDLVGLADWERYLPAELSGGMQQRVGLARALAVD 186 Query: 187 TDIILMDEAFSALDPLIRAEMQDQLLELQKTLHKTIVFITHDLDEAVRIGNRIAILKDGK 246 +I+LMDEAFSALDPLIR +MQD+ L+L + + KTIVFITHDLDEA+R+ +RIA++K+G+ Sbjct: 187 PEILLMDEAFSALDPLIRRQMQDEFLKLVEIVKKTIVFITHDLDEALRLADRIAVMKEGR 246 Query: 247 LIQVGTPREILHSPADEYVDRFV 269 ++Q+GTP +I+ PAD+YV+ FV Sbjct: 247 IVQIGTPEQIVMDPADDYVEEFV 269 Lambda K H 0.321 0.138 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 343 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 401 Length adjustment: 28 Effective length of query: 248 Effective length of database: 373 Effective search space: 92504 Effective search space used: 92504 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory