Align NatD aka LivH aka SLR0949, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized)
to candidate WP_073036690.1 BUB04_RS02685 branched-chain amino acid ABC transporter permease
Query= TCDB::P74318 (286 letters) >NCBI__GCF_900129305.1:WP_073036690.1 Length = 297 Score = 164 bits (416), Expect = 2e-45 Identities = 101/288 (35%), Positives = 169/288 (58%), Gaps = 18/288 (6%) Query: 5 QLIFNGIAVGSIIALGAVGLTLTYGILRLSNFAHGDFMTLAAYLTWWANTSGINLW---- 60 Q + NGI++GS+ AL A+G T+ YGILRL NFAHGD + +AAY +A T W Sbjct: 8 QQLTNGISLGSLYALVAIGYTMVYGILRLINFAHGDLLMVAAYTAIYAVTMFTLPWYLSF 67 Query: 61 -LSMAL-GCVGTIIAMFIGEWLLWKPMRARRATATTLIIISIGLALFLRNGILLIWGGNN 118 L++AL GC+G ++ + + +KP+ R A +L+I +IG + L N L+I GG Sbjct: 68 PLAIALTGCIGILL-----DRVAYKPL--RDAPRISLLISAIGASFLLENLALVIIGGVP 120 Query: 119 QNYRVPIVPAQ--DFMGIKFEYYRLLVIAMAIAAMVVLHLILQRTKVGKAMRAVADNVDL 176 + + P + A+ + +G++ + + + M + ++ L I+ RTKVGKAMRA + +++ Sbjct: 121 KGFPRPDIFAKVIEILGVRIQVLTIYIPLMTLVFLMALLYIVYRTKVGKAMRAASKDIET 180 Query: 177 AKVSGINVEWVVMWTWVMTAVLTALGGSMYGL-MTTLKPNMGWFLILPMFASVILGGIGN 235 ++ GINV+ ++ T++M + L A GG M+ + + P MG L F + +LGGIGN Sbjct: 181 TRLMGINVDRIIALTFLMGSSLAAAGGIMWAMKYPQVNPFMGVIPGLKAFIAAVLGGIGN 240 Query: 236 PYGAIAGGIIIGVAQEVSVPWFG--TSYKMGVALLLMIIILFIRPQGL 281 GA+ GG +G+ + + V +F Y+ A +++I++L RP G+ Sbjct: 241 IIGAVVGGFALGLGEILLVAFFPQLAQYRDAFAFVILILVLLFRPTGI 288 Lambda K H 0.329 0.143 0.450 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 215 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 286 Length of database: 297 Length adjustment: 26 Effective length of query: 260 Effective length of database: 271 Effective search space: 70460 Effective search space used: 70460 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory