Align NatD, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized)
to candidate WP_073036690.1 BUB04_RS02685 branched-chain amino acid ABC transporter permease
Query= TCDB::Q8YXD0 (288 letters) >NCBI__GCF_900129305.1:WP_073036690.1 Length = 297 Score = 167 bits (424), Expect = 2e-46 Identities = 97/285 (34%), Positives = 165/285 (57%), Gaps = 12/285 (4%) Query: 7 QLIVNGIAVGSIIALAAVGLTLTYGILRLSNFAHGDFLTLGAYLTFFVNTFGVNIW---L 63 Q + NGI++GS+ AL A+G T+ YGILRL NFAHGD L + AY + T W Sbjct: 8 QQLTNGISLGSLYALVAIGYTMVYGILRLINFAHGDLLMVAAYTAIYAVTMFTLPWYLSF 67 Query: 64 SMIVAVVGTVGVMLLSEKLLWSRMRSIRANSTTLIIISIGLALFLRNGIILIWGGRNQNY 123 + +A+ G +G++L +++ + +R A +L+I +IG + L N ++I GG + + Sbjct: 68 PLAIALTGCIGILL--DRVAYKPLRD--APRISLLISAIGASFLLENLALVIIGGVPKGF 123 Query: 124 NLP--ITPALDIFGVKVPQNQLLVLALAVLSIGALHYLLQNTKIGKAMRAVADDLDLAKV 181 P ++I GV++ + + + ++ + AL Y++ TK+GKAMRA + D++ ++ Sbjct: 124 PRPDIFAKVIEILGVRIQVLTIYIPLMTLVFLMALLYIVYRTKVGKAMRAASKDIETTRL 183 Query: 182 SGIDVEQVIFWTWLIAGTVTSLGGSMYGL-ITAVRPNMGWFLILPLFASVILGGIGNPYG 240 GI+V+++I T+L+ ++ + GG M+ + V P MG L F + +LGGIGN G Sbjct: 184 MGINVDRIIALTFLMGSSLAAAGGIMWAMKYPQVNPFMGVIPGLKAFIAAVLGGIGNIIG 243 Query: 241 AIAAAFIIGIVQEVSTPFLG--SQYKQGVALLIMILVLLIRPKGL 283 A+ F +G+ + + F +QY+ A +I+ILVLL RP G+ Sbjct: 244 AVVGGFALGLGEILLVAFFPQLAQYRDAFAFVILILVLLFRPTGI 288 Lambda K H 0.328 0.144 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 223 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 288 Length of database: 297 Length adjustment: 26 Effective length of query: 262 Effective length of database: 271 Effective search space: 71002 Effective search space used: 71002 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory