Align monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized)
to candidate WP_073037017.1 BUB04_RS03595 ABC transporter ATP-binding protein
Query= BRENDA::Q97UY8 (353 letters) >NCBI__GCF_900129305.1:WP_073037017.1 Length = 362 Score = 207 bits (528), Expect = 3e-58 Identities = 115/327 (35%), Positives = 194/327 (59%), Gaps = 25/327 (7%) Query: 2 VRIIVKNVSKVFKKG--KVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPST 59 + I + ++K+++ K+ ALD V++ + F +LGPSG GKTT +R + GL+ P Sbjct: 1 MEIRITGLTKIYESEGKKIHALDRVDLTVPANHIFTLLGPSGCGKTTLLRCLVGLESPDE 60 Query: 60 GELYFDDRLVASNGK-LIVPPEDRKIGMVFQTWALYPNLTAFENIAFPLTNMKMSKEEIR 118 GE+ + +V S K + VPPE R +GMVFQT+A++P++T F+N+A+PL ++ ++EIR Sbjct: 61 GEISIGEEVVWSREKGVFVPPEKRGLGMVFQTYAIWPHMTVFDNVAYPLQVRRLPRDEIR 120 Query: 119 KRVEEVAKILDIHHVLNHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDS 178 +V V K++ + + N +LSGGQQQRVALARALV +P ++L DEP SNLDA++R+ Sbjct: 121 SKVAAVLKLVQLDALENRPATKLSGGQQQRVALARALVAEPKVILFDEPLSNLDAKLREE 180 Query: 179 ARALVKEVQSRLGVTLLVVSHDPADIFAIADRVGVLVKGKLVQVGKPEDLYDNPVSIQVA 238 R +++ + LG+T + V+HD + +++D + V+ G++V++G P+ +Y VA Sbjct: 181 TRKELRQFLTELGITAVYVTHDRVEALSLSDSIAVMKDGQIVEIGSPQKIYFQAEHPFVA 240 Query: 239 SLIGEINELEGKV-TNEGVVIG---------SLRFPVSVSSDRAIIGIRPEDVKLSKDVI 288 IG N + G V T E ++ + R P D + +RPE +++ D + Sbjct: 241 DFIGRANLIPGTVETREEDLVAVETPIGKVLAARGPKVARGDEVTVCVRPEFIRVVADPL 300 Query: 289 KD---------DSWILVG---KGKVKV 303 + +S + VG +G+V+V Sbjct: 301 AEGINTFSGVVESLVFVGEAHEGEVRV 327 Lambda K H 0.319 0.139 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 330 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 353 Length of database: 362 Length adjustment: 29 Effective length of query: 324 Effective length of database: 333 Effective search space: 107892 Effective search space used: 107892 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory