Align ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized)
to candidate WP_073037051.1 BUB04_RS03685 ABC transporter ATP-binding protein
Query= reanno::WCS417:GFF4321 (386 letters) >NCBI__GCF_900129305.1:WP_073037051.1 Length = 361 Score = 205 bits (522), Expect = 1e-57 Identities = 131/348 (37%), Positives = 194/348 (55%), Gaps = 21/348 (6%) Query: 1 MATLELRNVNKTYGAGLPD----TLKNIELSIKEGEFLILVGPSGCGKSTLMNCIAGLET 56 MA + L+ V +Y D LKNI+ ++G L+GPSGCGK+T++N I+GL T Sbjct: 1 MARITLQEVAHSYRRHPKDPSDYALKNIDTVWEDGGAYALLGPSGCGKTTMLNIISGLLT 60 Query: 57 ITGGAIMIGDQDVSGMSPKDRDIAMVFQSYALYPTMSVRENIEFGLKIRKMPQADIDAEV 116 T G ++ D+DV+ + P+ R+IA VFQ LY TMSV +N+ F L+ R + + V Sbjct: 61 PTRGRVLYDDRDVTRLPPEQRNIAQVFQFPVLYDTMSVFDNLAFPLRNRGLDPQTVRRRV 120 Query: 117 ARVAKLLQIEHLLNRKPGQLSGGQQQRVAMGRALARRP-KIYLFDEPLSNLDAKLRVEMR 175 VA++L + L +K LS +Q++++GR L R LFDEPL+ +D L+ +R Sbjct: 121 QEVAEVLDLTADLKKKAAGLSADAKQKISLGRGLVREDVAAILFDEPLTVIDPHLKWHLR 180 Query: 176 TEMKLMHQRLKTTTVYVTHDQIEAMTLGDKVAVMKDGIIQQFGTPKEIYNNPANQFVASF 235 ++K +H+RL+ T +YVTHDQ+EA+T DKV VM +G + Q GTP E++ P ++FV F Sbjct: 181 RKLKEIHERLRLTLIYVTHDQVEALTFADKVLVMYEGEVVQMGTPTELFEEPRHKFVGYF 240 Query: 236 IGSPPMNFVPLRLQRK----DGRLVALLDSGQARCELALNTTEAGLEDRDVILGLRPEQI 291 IGSP MNF+P +L DG V LD AR A ++ LG+RP + Sbjct: 241 IGSPGMNFIPCKLDGARAVFDGAAVP-LDEETAR--------RAREKEGPFELGIRPMYL 291 Query: 292 MLAAGEGDSASSIRAEVQVTEPTGPDTLVFVQLNDTKVCCRLAPDVAP 339 + GD ++ V E G ++ VQL + RL P+ P Sbjct: 292 EVHDSPGDDRLPVK--VLKVEDQGIFRILTVQLASNTLKVRL-PEEKP 336 Lambda K H 0.318 0.135 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 320 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 386 Length of database: 361 Length adjustment: 30 Effective length of query: 356 Effective length of database: 331 Effective search space: 117836 Effective search space used: 117836 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory