Align 6-phosphofructokinase (EC 2.7.1.11) (characterized)
to candidate WP_073039722.1 BUB04_RS11760 1-phosphofructokinase
Query= BRENDA::P06999 (309 letters) >NCBI__GCF_900129305.1:WP_073039722.1 Length = 312 Score = 166 bits (420), Expect = 7e-46 Identities = 108/301 (35%), Positives = 155/301 (51%), Gaps = 3/301 (0%) Query: 4 IYTLTLAPSLDSATITPQIYPEGKLRCTAPVFEPGGGGINVARAIAHLGGSATAIFPAGG 63 IYT+TL P+LD + ++ + +R + GG GI+V+R I L G + A+ GG Sbjct: 2 IYTVTLNPALDRTLVVDRLVEDDTVRIRKETYYAGGKGIDVSRVIRELEGHSVALGFVGG 61 Query: 64 ATGEHLVSLLADENVPVATVEAKDWTRQNLHVHVEASGEQYRFVMPGAALNEDEFRQLEE 123 G HL LL + V V TR N+ V +G Q+ G + E +L Sbjct: 62 YDGSHLEGLLINAGVLTDFVRIGGETRTNIIVKEAETGRQFVLSAGGPEVRAAEIGELYH 121 Query: 124 QVLEIESGAILVISGSLPPGVKLEKLTQLISAAQKQGIRCIVDSSGEALSAALAIGNIEL 183 Q+L + +V+SGSLP GV QL+ AA+K+G ++D+ GEAL AL Sbjct: 122 QILRLPDMEYMVLSGSLPRGVSPNVYGQLVLAARKKGAFVMLDADGEALREALNY-RPHC 180 Query: 184 VKPNQKELSALVNRELTQPDDVRKAAQEIVNSGKAKRVVVSLGPQGALGVDSEN-CIQVV 242 +KPN+ ELS LV R+++ +++ A +EI G V+VS G G + +E IQ V Sbjct: 181 IKPNRHELSRLVGRDVSSQEEILAACREIHRRG-VPLVLVSRGKDGLILSGAEGPAIQAV 239 Query: 243 PPPVKSQSTVGAGDSMVGAMTLKLAENASLEEMVRFGVAAGSAATLNQGTRLCSHDDTQK 302 P V+ STVGAGDS V L + SLEE VR AAG+A + GT LC ++ Sbjct: 240 GPAVQVDSTVGAGDSAVAGFILAHSRRQSLEECVRLACAAGTATAMTPGTELCHRQTVEE 299 Query: 303 I 303 + Sbjct: 300 L 300 Lambda K H 0.314 0.131 0.363 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 221 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 309 Length of database: 312 Length adjustment: 27 Effective length of query: 282 Effective length of database: 285 Effective search space: 80370 Effective search space used: 80370 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory