Align LacK, component of Lactose porter (characterized)
to candidate WP_073037017.1 BUB04_RS03595 ABC transporter ATP-binding protein
Query= TCDB::Q01937 (363 letters) >NCBI__GCF_900129305.1:WP_073037017.1 Length = 362 Score = 229 bits (583), Expect = 1e-64 Identities = 130/296 (43%), Positives = 181/296 (61%), Gaps = 16/296 (5%) Query: 3 EVRLTDIRKSYGS----LEVIKGVNLEVSSGEFVVFVGPSGCGKSTLLRMIAGLEDISSG 58 E+R+T + K Y S + + V+L V + +GPSGCGK+TLLR + GLE G Sbjct: 2 EIRITGLTKIYESEGKKIHALDRVDLTVPANHIFTLLGPSGCGKTTLLRCLVGLESPDEG 61 Query: 59 ELTIGGTVMND------VDPSKRGIAMVFQTYALYPHMTVRENMGFALRFAGMAKDEIER 112 E++IG V+ V P KRG+ MVFQTYA++PHMTV +N+ + L+ + +DEI Sbjct: 62 EISIGEEVVWSREKGVFVPPEKRGLGMVFQTYAIWPHMTVFDNVAYPLQVRRLPRDEIRS 121 Query: 113 RVNAAAKILELDALMDRKPKALSGGQRQRVAIGRAIVRQPDVFLFDEPLSNLDAELRVHM 172 +V A K+++LDAL +R LSGGQ+QRVA+ RA+V +P V LFDEPLSNLDA+LR Sbjct: 122 KVAAVLKLVQLDALENRPATKLSGGQQQRVALARALVAEPKVILFDEPLSNLDAKLREET 181 Query: 173 RVEIARLHKELNATIVYVTHDQVEAMTLADKIVVMRGGIVEQVGAPLALYDDPDNMFVAG 232 R E+ + EL T VYVTHD+VEA++L+D I VM+ G + ++G+P +Y ++ FVA Sbjct: 182 RKELRQFLTELGITAVYVTHDRVEALSLSDSIAVMKDGQIVEIGSPQKIYFQAEHPFVAD 241 Query: 233 FIGSPRMNFLPAVVIGQAEGGQVTVALKARPDTQLTVACATPPQGGDAVTVGVRPE 288 FIG R N +P G E + + P ++ A GD VTV VRPE Sbjct: 242 FIG--RANLIP----GTVETREEDLVAVETPIGKVLAARGPKVARGDEVTVCVRPE 291 Lambda K H 0.320 0.137 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 327 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 363 Length of database: 362 Length adjustment: 29 Effective length of query: 334 Effective length of database: 333 Effective search space: 111222 Effective search space used: 111222 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory