Align Amino-acid ABC transporter, ATP-binding protein (characterized, see rationale)
to candidate WP_073037863.1 BUB04_RS05930 amino acid ABC transporter ATP-binding protein
Query= uniprot:Q88GX0 (260 letters) >NCBI__GCF_900129305.1:WP_073037863.1 Length = 256 Score = 329 bits (844), Expect = 3e-95 Identities = 162/251 (64%), Positives = 199/251 (79%), Gaps = 3/251 (1%) Query: 13 EPDPRP---VLIRIEGLNKHYGAFHVLRDIDLQVREGERIVLCGPSGSGKSTLIRCINRL 69 E PRP V++ I L+K +G FHVL+ I+L+V + ERIV+CGPSGSGKSTLIRCINRL Sbjct: 6 ESRPRPDSEVMVEIIDLHKWFGEFHVLKGINLKVNKQERIVICGPSGSGKSTLIRCINRL 65 Query: 70 EVAQQGSIQVDGIDLAATTREAAQVRSDIGMVFQHFNLFPHMSVLDNCLLAPTSVRGLSR 129 E Q+G I VDGI+L + ++RS++GMVFQHFNLFPH++VLDN L P VR + R Sbjct: 66 EEHQRGRIIVDGIELTNNIKNIEKIRSEVGMVFQHFNLFPHLTVLDNLTLGPIWVRKVPR 125 Query: 130 KDAEERARMYLSKVGIESQAHKYPSQLSGGQQQRVAIARALCMKPRIMLFDEPTSALDPE 189 K+AEE A YL KV I QAHKYP QLSGGQQQRVAIAR+LCM P++MLFDEPTSALDPE Sbjct: 126 KEAEETAMYYLEKVHIAEQAHKYPGQLSGGQQQRVAIARSLCMSPKVMLFDEPTSALDPE 185 Query: 190 MVAEVLDVLVQLAGTGMTMLCVTHEMGFARQVAERVLFLEGGQIIEDSPPQVFFNQPRTE 249 M+ EVLDV+++LA GMTM+ VTHEMGFAR VA RVLF++GGQ++E++ P+ FFN P+ E Sbjct: 186 MIKEVLDVMIELAQEGMTMIVVTHEMGFARSVAHRVLFMDGGQVVEENTPEEFFNNPQHE 245 Query: 250 RAKAFLAQILH 260 R K FL+QILH Sbjct: 246 RTKLFLSQILH 256 Lambda K H 0.322 0.137 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 238 Number of extensions: 4 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 256 Length adjustment: 24 Effective length of query: 236 Effective length of database: 232 Effective search space: 54752 Effective search space used: 54752 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory