Align MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized)
to candidate WP_073038605.1 BUB04_RS08650 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= TCDB::Q8DT25 (377 letters) >NCBI__GCF_900129305.1:WP_073038605.1 Length = 368 Score = 367 bits (943), Expect = e-106 Identities = 198/381 (51%), Positives = 263/381 (69%), Gaps = 19/381 (4%) Query: 1 MTTLKLDNIYKRYPNAKHYSVENFNLDIHDKEFIVFVGPSGCGKSTTLRMIAGLEDITEG 60 M +KLD + KR+ K++ V +F L + DKEF+V VGPSGCGKSTTLRMIAGLE++T G Sbjct: 1 MAEIKLDQVNKRFK--KNWVVRDFTLTVADKEFVVLVGPSGCGKSTTLRMIAGLEEVTSG 58 Query: 61 NLYIDDKLMNDASPKDRDIAMVFQNYALYPHMSVYENMAFGLKLRKYKKDDINKRVHEAA 120 + I +++N PKDRDIAMVFQ+YALYPHM+VY+NMAFGL R +D+I++RV +AA Sbjct: 59 EISIGGRVVNHVPPKDRDIAMVFQSYALYPHMNVYKNMAFGLMNRGVPRDEIDRRVKQAA 118 Query: 121 EILGLTEFLERKPADLSGGQRQRVAMGRAIVRDAKVFLMDEPLSNLDAKLRVAMRAEIAK 180 EILG+++ L+R+PA LSGGQRQRVAMGRAIVRD + FL DEPLSNLDAKLRV MRAE+AK Sbjct: 119 EILGISDLLQRRPAQLSGGQRQRVAMGRAIVRDPQAFLFDEPLSNLDAKLRVQMRAELAK 178 Query: 181 IHRRIGATTIYVTHDQTEAMTLADRIVIMSATPNPDKTGSIGRIEQIGTPQELYNEPANK 240 +H R+ +T +YVTHDQ EAMTLADRIV+M G+I Q+G P E+Y PAN+ Sbjct: 179 LHERLQSTIVYVTHDQIEAMTLADRIVVMKD----------GKIMQVGPPLEVYERPANR 228 Query: 241 FVAGFIGSPAMNFFEV-TVEKERLVNQDGLSLALPQGQEKILEEKGYLGKKVTLGIRPED 299 FVAGFIGSP+MNF +V VE+ + DG S L + + +G++ + V GIRPED Sbjct: 229 FVAGFIGSPSMNFLDVRLVEEAGDLWVDGESFRLKVPRHRAPAFRGHVNRPVIFGIRPED 288 Query: 300 IS---SDQIVHETFPNASVTADILVSELLGSESMLYVKFGSTEFTARVNARDSHSPGEKV 356 + D + P + A++ V E +GSE ++ GS FTAR++ + + + Sbjct: 289 VKERPGDALPEGVEP---LRAEVDVREPIGSEVIITATVGSHAFTARISPNVAVRVHDPI 345 Query: 357 QLTFNIAKGHFFDLETEKRIN 377 L N+ K H FD E+E+ +N Sbjct: 346 DLAVNMNKMHLFDPESEQALN 366 Lambda K H 0.318 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 419 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 368 Length adjustment: 30 Effective length of query: 347 Effective length of database: 338 Effective search space: 117286 Effective search space used: 117286 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory