Align cyclohex-1-ene-1-carbonyl-CoA dehydrogenase (EC 1.3.8.10) (characterized)
to candidate WP_073041036.1 BUB04_RS15245 acyl-CoA dehydrogenase family protein
Query= BRENDA::Q39QF5 (380 letters) >NCBI__GCF_900129305.1:WP_073041036.1 Length = 384 Score = 268 bits (684), Expect = 2e-76 Identities = 159/381 (41%), Positives = 223/381 (58%), Gaps = 8/381 (2%) Query: 4 LTEEQKLTLDMVRDVATREIAPRALELDEKSLFPEYARDLFAKLGLLNPLLPAAYGGTEM 63 + E ++ + VR R++ P + +++++ PE LGL +P YGG + Sbjct: 5 IPENLRMMQETVRRFVERDLEPISRQVEDEDRIPEETVQKMRDLGLFGLAIPEEYGGLGL 64 Query: 64 GVLTLALILEELGRVCASTALLLIAQTD-GMLPIIHGGSPELKERYLRRFA-GESTLLTA 121 GVL L+ +EL + A + G I+ G+ E K+RYL + A GE T A Sbjct: 65 GVLGECLVYQELSKTNACFRSRIGTNNGIGSQGIVIDGTEEQKQRYLPKLASGEWTACFA 124 Query: 122 LAATEPAAGSDLLAMKTRAVRQGDKYVINGQKCFITNGSVADVIVVYAYTDPEKGSKG-I 180 L TEP AGSD A++TRA +GD +V+NG+K FITNG +ADV V+A TDPEK ++G I Sbjct: 125 L--TEPEAGSDAAAIRTRAELRGDHWVLNGKKHFITNGDIADVATVFAVTDPEKRARGGI 182 Query: 181 SAFVVEKGTPGLVYGRNESKMGMRGSINSELFFENMEVPAENIIGAE---GTGFANLMQT 237 +AF+VE+ PG G E KMG+RG+ +EL FE+ VP EN+IG E G GF M+ Sbjct: 183 TAFIVERTFPGYSVGTIERKMGLRGNHTAELIFEDCIVPRENVIGGEAMVGQGFKTAMKV 242 Query: 238 LSTNRVFCAAQAVGIAQGALDIAVRHTQDRVQFGKPIAHLAPVQFMVADMATAVEASRLL 297 L R+ A AVG A+ L++++ + + RVQFGKPIA +QFM+ADMAT + A+R + Sbjct: 243 LDKGRLTMGASAVGTAEKLLELSIDYAKQRVQFGKPIAEFQAIQFMLADMATQIYAARNM 302 Query: 298 TRKAAELLDDGDKKAVLYGSMAKTMASDTAMRVTTDAVQVLGGSGYMKENGVERMMRDAK 357 AA L D V SM K ++ RV AVQ+ GG GYMK+ +ER RD + Sbjct: 303 LYHAAWLRDQRGTAVVKEASMVKLFCTEMVNRVADMAVQIHGGMGYMKDYPIERFYRDVR 362 Query: 358 LTQIYTGTNQITRMVTGRALL 378 LT+IY GT++I R+V R LL Sbjct: 363 LTRIYEGTSEIQRLVIARELL 383 Lambda K H 0.319 0.134 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 376 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 380 Length of database: 384 Length adjustment: 30 Effective length of query: 350 Effective length of database: 354 Effective search space: 123900 Effective search space used: 123900 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory