Align cyclohexa-1,5-dienecarbonyl-CoA hydratase monomer (EC 4.2.1.100) (characterized)
to candidate WP_073038418.1 BUB04_RS07705 enoyl-CoA hydratase
Query= metacyc::MONOMER-18320 (256 letters) >NCBI__GCF_900129305.1:WP_073038418.1 Length = 260 Score = 140 bits (353), Expect = 3e-38 Identities = 95/257 (36%), Positives = 140/257 (54%), Gaps = 8/257 (3%) Query: 6 ILFEKKDKVATITLNVPN-SNWLTIPMMKEINEALMDVKKDPTIQLLVFDHAGDKAFCDG 64 +L E++ +VA +TLN P N L M++ ++E + ++ D +++++ AG KAFC G Sbjct: 6 VLEERQGQVAILTLNRPEVMNSLNFAMLRGLHEKVESLRFDNDVRVIIITGAGPKAFCAG 65 Query: 65 VDVADHVP---EKVDEMIDLFHGMFRNMAAMDVTSVCLVNGRSLGGGCELMAFCDIVIAS 121 D+ + ++V E I +F N+ + + VNG +LGGG EL CDI IAS Sbjct: 66 ADLKERATLNDQQVKEFILTIRNLFTNIEYLPKPVIAAVNGIALGGGTELALACDIRIAS 125 Query: 122 EKAKIGQPEINLAVFPPVAAAW-FPKIMGLKKAMELILTGKIISAKEAEAIGLVNVVLPV 180 A +G E LA+ P P+++G KA ELI TG+ + A+EA +IGLVN V Sbjct: 126 TTATMGLTETRLAIIPGAGGTQRLPRLVGRGKAKELIFTGRRVGAEEALSIGLVNQVAEP 185 Query: 181 EGFREAAQKFMADFTSKSRPVAM-WARRAIMAGLNLDFLQALKASEIIYMQGCMATEDAN 239 E +A + MA ++ P+A+ A+ AI GL D L Y + TED Sbjct: 186 EKLLDACLE-MAGMICETGPIAIQQAKYAINYGLETDLHTGLAIESNAYWI-TIPTEDRL 243 Query: 240 EGLASFLEKRKPVFKDK 256 EGLA+F EKRKPV+K K Sbjct: 244 EGLAAFREKRKPVYKGK 260 Lambda K H 0.322 0.136 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 138 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 256 Length of database: 260 Length adjustment: 24 Effective length of query: 232 Effective length of database: 236 Effective search space: 54752 Effective search space used: 54752 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory