Align 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase (EC 5.3.3.18) (characterized)
to candidate WP_073038817.1 BUB04_RS09760 enoyl-CoA hydratase/isomerase family protein
Query= BRENDA::P77467 (262 letters) >NCBI__GCF_900129305.1:WP_073038817.1 Length = 259 Score = 157 bits (397), Expect = 2e-43 Identities = 95/250 (38%), Positives = 132/250 (52%), Gaps = 7/250 (2%) Query: 13 VMTLTLNRPERLNSFNDEMHAQLAECLKQVERDDTIRCLLLTGAGRGFCAGQDLNDRNVD 72 V + +NRP+ LN+ N ++ +LA+ L D ++R +LLTG G+ FCAG DL Sbjct: 13 VREVAMNRPKNLNALNLQLMTELADALTAAAADASVRGVLLTGRGKAFCAGGDLKWA--- 69 Query: 73 PTGPAPDLGMSVERFYNPLVR---RLAKLPKPVICAVNGVAAGAGATLALGGDIVIAARS 129 A D G+S L R L +PKPV AV G AAGAG TLAL D + +S Sbjct: 70 -LDFADDPGVSFHTLAGQLNRVAVELRNMPKPVAAAVQGAAAGAGFTLALACDFRVMEKS 128 Query: 130 AKFVMAFSKLGLIPDCGGTWLLPRVAGRARAMGLALLGNQLSAEQAHEWGMIWQVVDDET 189 A F A++ GL D GGT+ LPR+ G ARA+ +A ++ AE+A EWG++ ++ +D Sbjct: 129 AFFQQAYTSNGLCIDGGGTFTLPRLVGMARALEIAAFDERIPAEKALEWGLVTRLAEDGA 188 Query: 190 LADTAQQLARHLATQPTFGLGLIKQAINSAETNTLDTQLDLERDYQRLAGRSADYREGVS 249 D A + LA + K N A N +TQ + ER R D REG+ Sbjct: 189 ARDEALDMLNRLAERSLHSFARCKDLFNRAFQNDFETQAERERRALAACARHEDGREGLR 248 Query: 250 AFLAKRSPQF 259 AF+ KR P+F Sbjct: 249 AFVEKRPPKF 258 Lambda K H 0.321 0.136 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 142 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 259 Length adjustment: 25 Effective length of query: 237 Effective length of database: 234 Effective search space: 55458 Effective search space used: 55458 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory